KEGG   Olleya sp. Bg11-27: CW732_02220Help
Entry
CW732_02220       CDS       T05214                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
oll  Olleya sp. Bg11-27
Pathway
oll00010  Glycolysis / Gluconeogenesis
oll00053  Ascorbate and aldarate metabolism
oll00071  Fatty acid degradation
oll00280  Valine, leucine and isoleucine degradation
oll00310  Lysine degradation
oll00330  Arginine and proline metabolism
oll00340  Histidine metabolism
oll00380  Tryptophan metabolism
oll00410  beta-Alanine metabolism
oll00561  Glycerolipid metabolism
oll00620  Pyruvate metabolism
oll00625  Chloroalkane and chloroalkene degradation
oll01100  Metabolic pathways
oll01110  Biosynthesis of secondary metabolites
oll01120  Microbial metabolism in diverse environments
oll01130  Biosynthesis of antibiotics
Module
oll_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:oll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CW732_02220
   00053 Ascorbate and aldarate metabolism
    CW732_02220
   00620 Pyruvate metabolism
    CW732_02220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CW732_02220
   00561 Glycerolipid metabolism
    CW732_02220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CW732_02220
   00310 Lysine degradation
    CW732_02220
   00330 Arginine and proline metabolism
    CW732_02220
   00340 Histidine metabolism
    CW732_02220
   00380 Tryptophan metabolism
    CW732_02220
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CW732_02220
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CW732_02220
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CW732_02220
Enzymes [BR:oll01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CW732_02220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AUC74556
UniProt: A0A2K8WVE8
LinkDB All DBs
Position
complement(517887..519440)
Genome map
AA seq 517 aa AA seqDB search
MQAVSADFGIKEALKQLGLKDINEGTSTGLNNFGSGELIESYSPTDGKLIGKVSTTTKAD
YEKVINKATEAFVGFRAMPAPQRGEIVRQFGNKLRALKEPLGKLVSYEMGKSLQEGYGEV
QEMIDICDFAVGLSRQLNGQTIPSERPGHVMREQWHSLGVVGIISAFNFPVAVWAWNTAL
AWVCGDVCIWKGSEKAPLCSVACQNIIASVLKENNLPEGISAIINGDYKVGEFMTTDHRI
PLISATGSTRMGRIVGATVAERFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAVGTCG
QRCTSTRRLIIHESVYDKVRDAIVGAYGQLTIGNPLDEKNHIGPLIDKDSVNTYLAAIEK
AKAEGGKVLVEGGVLEGEGYESGCYVKPAIIEAKNDFEIVQSETFAPVLYLIKYSGDVEN
AIAAQNGVAQGLSSAIMTNELKEAEKFLSFAGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTVNYSDELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagtttcagctgatttcggaataaaagaagccttaaaacaattagggttaaaa
gatataaatgaaggaacatctacaggtttaaataactttggaagtggagagttaattgag
tcttactcgccaacagatggtaaattaataggtaaagtatcaacaacgactaaagccgat
tacgaaaaagtaatcaataaagcaacggaagcttttgttggatttagagcaatgcctgcc
ccacaaagaggagagattgtaagacaatttggaaataaattaagagcattaaaagaacct
ttaggaaagttagtctcttatgagatgggtaaatctttacaagaaggttacggagaagtt
caagaaatgattgatatctgtgactttgctgtcgggttatcaagacaactaaatgggcaa
acaataccttcagaacgtccaggtcatgtcatgcgtgagcagtggcactctttaggtgtt
gttggaataatctcagcatttaactttcctgtagcggtttgggcttggaatacagcttta
gcttgggtttgtggtgatgtatgtatctggaaggggtcagaaaaagcaccgctttgctcg
gtagcttgtcaaaatattattgcatcagttttaaaagaaaataacttgccagaaggtatt
tctgctattatcaatggagactacaaagtgggtgagtttatgacaactgatcacagaatt
ccattaatatctgcaacagggtctactagaatgggacgtattgttggagcaacagtagcg
gagcgttttggaaaatcgttattagagttaggaggaaacaatgctattattatcacgcca
actgcagatttaaaagtggtagttcctggtgctgtatttggtgctgttggtacttgtgga
caacgttgtacatctactagaagactaattattcacgaatcagtttacgataaagtaaga
gatgcaattgttggtgcttacggacaattaactattggaaatccattggatgagaaaaac
catattggaccgttaatagataaagattctgtaaatacttatttagctgctattgaaaaa
gcaaaagctgaaggtggtaaagtactagtggaaggtggtgttttggaaggtgaaggttat
gagtctggatgttatgttaagccggctattattgaggctaaaaacgatttcgaaatcgta
caatcggaaacatttgcgccagtattatatttaattaaatattcaggtgatgtagaaaat
gcaattgctgctcaaaacggtgttgcacaagggttatcatctgcaattatgactaacgaa
ttgaaggaagctgaaaagtttttatcatttgcgggatcagattgtggaattgcaaatgta
aacatcggaacttctggagctgaaattggtggtgcttttggaggagaaaaagaaacaggt
ggtggacgtgagtctggatctgatgcttggaaagtatacatgagaagacaaacaaataca
gtaaattattctgacgaattgcctttagctcaaggtattaagtttgatttataa

DBGET integrated database retrieval system