KEGG   Olleya sp. Bg11-27: CW732_02445Help
Entry
CW732_02445       CDS       T05214                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
oll  Olleya sp. Bg11-27
Pathway
oll00240  Pyrimidine metabolism
oll01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oll00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CW732_02445
Enzymes [BR:oll01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CW732_02445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AUC74599
UniProt: A0A2K8WVD9
LinkDB All DBs
Position
568873..569523
Genome map
AA seq 216 aa AA seqDB search
MFLENTVNQKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAIDTRYDEEM
VVSHDSNEIRSTPVPAAANIPILADGCDVVGIDEAQFFDDEIVRVCNDLANKGIRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSFRKSANDNLVLLGETEEYEP
LSRAAYYKATLREKIKDIKVQDAEEVDQKLNTSNDQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaatacagtaaatcaaaaagaacaatttggatggattgaagtcatctgt
ggatcaatgttttctggtaaaacagaagagctaatccgcaggcttaaacgtgcccaattt
gctaaacaaaaagttgaaatctttaaaccagctattgacacacgttatgacgaagagatg
gttgtctctcacgattctaacgaaatcagatcgactcccgtacccgcagctgcaaatatt
ccaatattagcagacggctgtgatgtggttggtattgacgaagcacaattttttgatgat
gagattgtcagagtttgtaacgacttagcaaacaaaggtattcgtgttattgttgctgga
ttagatatggactttaaaggaaacccttttgggccaatgcctaatctaatggcgactgcc
gagtatgtcacaaaagtacatgcagtatgcaccagaacaggaaatctggcgcaatatagt
ttcagaaaatctgcaaatgataatcttgtattattgggtgaaacagaagaatatgagcca
ttaagcagagctgcatattacaaagctaccctacgcgaaaaaatcaaagacattaaagta
caggatgccgaagaagttgatcaaaaactgaatacaagcaatgatcaataa

DBGET integrated database retrieval system