KEGG   Olleya sp. Bg11-27: CW732_05350Help
Entry
CW732_05350       CDS       T05214                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
oll  Olleya sp. Bg11-27
Pathway
oll00020  Citrate cycle (TCA cycle)
oll00310  Lysine degradation
oll00380  Tryptophan metabolism
oll01100  Metabolic pathways
oll01110  Biosynthesis of secondary metabolites
oll01120  Microbial metabolism in diverse environments
oll01130  Biosynthesis of antibiotics
oll01200  Carbon metabolism
Module
oll_M00009  Citrate cycle (TCA cycle, Krebs cycle)
oll_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:oll00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CW732_05350
  Amino acid metabolism
   00310 Lysine degradation
    CW732_05350
   00380 Tryptophan metabolism
    CW732_05350
Enzymes [BR:oll01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CW732_05350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AUC75131
UniProt: A0A2K8WWU5
LinkDB All DBs
Position
1234252..1237017
Genome map
AA seq 921 aa AA seqDB search
MDKYSFLNAAHTAYFADLYDQYLENPDSVEPSWRAFFQGYDFGSENYGLDGEIAEGVSTQ
MPEHVQKEFQVVKLIDGYRNRGHLFTKTNPVRDRRKYEPSLALENFGLTQADLDTNFNAG
DILGIGAQTLREIVKHLNSIYCDAIGVEYMYIRKPDEIQWIQSKLNINDNQPNFSGAQKK
HILKKLNEAVSFESFLHTKYVGQKRFSLEGGESLIPGLDAVIEKAAELGVQEFVMGMAHR
GRLSTLTNIFGKSAKDIFSEFDGKDYEQEVFDGDVKYHLGWTSNRQTNSGKKINLSIAPN
PSHLETVGAVVEGIVRAKQDNFYSDNFSKVLPIVVHGDAAIAGQGLVYEVVQMAQLDGYK
TNGTIHVVVNNQVGFTTNYLDARSSTYCTDIAKVTLSPVLHVNADDAEAVVHAMLFALDF
RMNFKRDVFIDLLGYRKYGHNEGDEPRFTQPKLYKAISKHANPRDIYAAKLIEQGIIDKD
HVKTLENEYKSSLEEKLEDSRKEDKTVITPFMEDQWKDFTQVDETIMMQPIDTTTSIEKL
AAITKVISNLPKDKKFIRKIERLINERQNMFDENRLDWAMAEHLAYGTLLDEGYNVRMSG
QDVERGTFSHRHAVVKVEDSEEEILLLNQINDKQGQFYIYNSLLSEYGVVGFDYGYAMAS
PNTLTIWEAQFGDFSNGAQIMLDQYISAGEDKWKTQNGLVMLLPHGYEGQGAEHSSARME
RYLQLCAKDNMFVADCTTPANFFHLLRRQMKVNFRKPLIVFTPKSLLRHPKCVSTVDEFA
NGSFQTLIDDASVKVDKVKTLVFLTGKFYYDLDEERDNLNRDDIAFVRIEQLFPLPTIAI
KDILGKYTNAEDIVWAQEEPRNMGAYSHMLMNLDEARDFRLASRRPYGAPAAGSSVRSKK
RHKEVIDFVFDKTKNNQRQAK
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggataaatactcctttttaaacgcagcacatacagcatactttgctgacttatacgat
caatacttagaaaaccctgactctgtagagcctagttggagagccttttttcaaggttac
gactttggttcggaaaattacggattagatggagaaatagcagagggtgtttccacccaa
atgcctgagcatgttcaaaaagaatttcaagtagtaaaattaatagatggttatcgtaac
agagggcatttatttactaaaacaaacccggtaagggatcgtcgtaagtacgagcctagt
ttggcattggaaaattttggtttgacacaagccgatttggataccaattttaatgctggt
gatattttaggtataggtgcacaaacacttagagaaattgttaaacatttaaatagtatt
tattgcgatgctattggagtggaatacatgtatatcagaaaacctgacgaaatacagtgg
attcagagcaaattaaatataaacgacaatcagcctaatttttctggagcgcaaaaaaag
cacatcctaaaaaaattaaatgaggccgtatcgtttgaaagttttctacatactaaatat
gtaggacaaaaacggttctctctggaaggaggggagtctttaatcccaggattagatgcc
gtaattgaaaaagcagcagaacttggtgttcaagaatttgtaatgggaatggcgcacaga
gggcgtttgagtaccttaacaaatatttttggaaagtctgcaaaagacatttttagcgag
tttgatggaaaggattacgagcaagaagtttttgatggagatgtcaagtatcatttaggt
tggactagtaatcgtcagactaatagtgggaaaaaaataaacctaagtattgcaccaaac
ccatcacacttagagacggttggagcagttgttgaaggtattgttagagcaaaacaagat
aatttttatagcgataactttagtaaagttttaccaatcgtagttcacggagatgcagca
atagcaggtcaaggattagtgtacgaagtggtacaaatggcacagttagatggttataaa
actaacgggacaattcacgtcgttgttaataatcaagtcggatttacaactaactattta
gacgctagatctagtacgtattgtacagatattgccaaagtaacgttatctccagtgtta
catgttaatgcagacgatgcagaagcagtagtgcatgcgatgttatttgcattagatttt
agaatgaattttaagcgtgacgtatttattgaccttttaggatatagaaaatacgggcat
aatgaaggtgatgaaccaagatttacgcaaccaaaattgtataaagcaatttctaaacat
gccaatccaagagatatctatgctgccaaactaattgagcaaggtattattgataaagac
catgttaagacattagaaaacgagtacaaatctagcttagaagaaaagttagaagattct
cgtaaagaagataaaacggtcatcaccccatttatggaggatcaatggaaagattttact
caggtagatgaaactattatgatgcaaccaattgatacaactacttctattgagaagtta
gcagctattaccaaagtaatctctaacttaccaaaagataaaaagtttatcagaaaaata
gaacgtctaatcaatgagcgtcaaaatatgtttgacgaaaatagattggattgggctatg
gcagaacatttagcatacggaacacttttagacgaaggttataatgtgcgtatgtcaggt
caagatgtagaacgtggtacgttttctcacagacacgcagttgtgaaagttgaggatagt
gaagaagaaattttattattaaaccaaataaatgataagcaaggtcaattttatatctat
aactctttactttcagagtatggcgtagtaggatttgattatgggtacgctatggcaagt
ccaaatactttaactatttgggaagcgcagtttggagattttagtaatggtgctcaaatc
atgctagatcaatatatttctgctggtgaagataagtggaaaactcaaaacggattagtc
atgttattaccacatggttatgaaggacaaggagcagagcactcttccgcacgtatggaa
cgttatttacagttgtgtgcaaaagataatatgtttgttgcagattgtacaacaccagct
aacttctttcacttgttaagacgtcaaatgaaggttaactttcgtaagccattaatcgtg
tttacgccaaaaagtttattacgtcatccaaaatgtgttagcacagtagatgagtttgca
aacggaagcttccaaacattgatagatgatgcctctgtaaaagtagataaagttaagact
cttgtctttttaacaggtaaattttattacgatttagacgaagagcgtgataacttaaat
agagatgatatcgcttttgttagaatagagcagttatttccattgccaactatagctata
aaagatatattaggaaagtatacaaatgcggaagatatcgtttgggcgcaagaagaacca
agaaatatgggagcctattcgcacatgttgatgaatttggacgaagcaagagattttaga
ctggcttctagaagaccttatggtgcgccagcagcgggtagctctgtgcgttctaaaaaa
cgtcataaagaagttatcgactttgtatttgataagactaaaaataaccagcgtcaagct
aaataa

DBGET integrated database retrieval system