KEGG   Olleya sp. Bg11-27: CW732_05980Help
Entry
CW732_05980       CDS       T05214                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
oll  Olleya sp. Bg11-27
Pathway
oll00564  Glycerophospholipid metabolism
oll01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oll00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CW732_05980
Enzymes [BR:oll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CW732_05980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 GIDA Lycopene_cycl FAD_binding_3 HI0933_like Pyr_redox_3 Thi4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AUC75246
UniProt: A0A2K8WXE3
LinkDB All DBs
Position
1368893..1370458
Genome map
AA seq 521 aa AA seqDB search
MFNREALVNQIKTNPNWDVIVIGGGATGLGVALDAGTRGYKTLLLEQVDFAKGTSSRSTK
LVHGGVRYLAQGNVDLVREALYERGLMMKNASHLVSKQSFIIPNYSWFDSIFYTIGLKVY
DFLSGKLSFGKSERINRRDTMSRLATLKNDKLKGGVVYYDGQFDDARLAINIAQSCIENG
ATVLNHFKVKTLLKNNKGKVDGVLASDGESGLDYKLKATVVINATGVFSDEVLKMDDVSA
RTSIKPSQGVHLVFDKSYLPGDDAIMIPKTDDGRVLFLVPWHDRVVVGTTDTLVDNHSLE
PQALDEEINFILQTANKYLNKKVSKKDVLSVFAGLRPLAAPKDNSTKTKEISRSHKIIVA
KSGLITITGGKWTTYRRMAQDTINKVIALKKLSKIKCKTKDLLIHGANGTVDRSNHLYIY
GTDQKHIVDLITDNPELSTRLHPRLEFTKAEVVWAVRNEMARTIEDVLARRVRVLFLDAK
AAIEIAPMVGELIREELQQTSEWKVKQISDFINIAQQYVLR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatagagaagctttagtaaatcaaataaaaactaaccctaattgggacgtcatt
gtaattggtggtggtgcaacaggtttgggagttgcattagatgcagggacaagaggttat
aaaacattattgttagaacaggtggattttgcaaaaggaacctctagtcgtagtacaaaa
ctagtgcatggtggtgttagatatttggcacaaggtaatgtggacttagtgcgtgaggct
ttgtatgaaagaggtttgatgatgaaaaatgcctctcatttagtaagtaaacaatctttt
attatacctaattatagctggtttgactctattttttatactattgggttaaaagtatac
gattttttatctggtaaattaagttttggtaaatccgaaaggataaatagacgggacacc
atgtctaggttggcaaccttaaaaaacgacaaattaaaaggtggcgtggtctattacgat
ggacagtttgatgatgctagactagctattaatatagcacaaagttgtattgaaaatggt
gcaactgttttaaatcattttaaggtcaaaacactgcttaaaaataacaaaggaaaagtg
gatggagtcctagcaagcgacggtgagtcgggacttgactataagttaaaagcaaccgtt
gtcattaatgcaacaggcgtgttttctgatgaggtattaaaaatggatgatgttagtgct
agaacctctataaagcctagtcaaggggttcatttagtttttgataagtcatatttgcct
ggtgatgatgctattatgattcctaaaacggacgatggtcgagttttgtttttagtgcct
tggcatgatagggtagtggttggtacaaccgatacgttggttgataaccatagtttagag
ccgcaagctttggatgaagaaattaattttatcctacaaacagcaaataagtatttaaat
aaaaaggtaagcaaaaaggatgtacttagtgtttttgctggtctcagaccgctggcagca
ccaaaggataattccacaaaaacaaaagaaatctccagaagccataaaattattgtggca
aagtcagggttaattacaattactggtggaaaatggactacttatagacgcatggcgcag
gatactattaataaagtaatagcgcttaaaaagttatcaaaaataaaatgtaaaacaaaa
gacttgctaatacatggcgcaaatgggacagtcgatagatccaatcatttatatatttat
ggaacagatcaaaaacatattgtagatttaattacagataatccggaattatcaacccgt
ttacatccacgtttagaatttacaaaagcagaagttgtttgggctgtaaggaatgaaatg
gcaagaactattgaggatgtgttggcaaggcgtgtgcgcgttttgtttttagatgctaaa
gcggcaatcgaaattgcaccaatggtcggagagcttatcagagaagaattacagcaaaca
tcagaatggaaagtgaagcaaatttcagactttattaatatagcacaacagtacgtttta
agataa

DBGET integrated database retrieval system