KEGG   Olleya sp. Bg11-27: CW732_06205
Entry
CW732_06205       CDS       T05214                                 

Gene name
metH
Definition
(GenBank) methionine synthase
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
oll  Olleya sp. Bg11-27
Pathway
oll00270  Cysteine and methionine metabolism
oll00450  Selenocompound metabolism
oll00670  One carbon pool by folate
oll01100  Metabolic pathways
oll01110  Biosynthesis of secondary metabolites
oll01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oll00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CW732_06205 (metH)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CW732_06205 (metH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CW732_06205 (metH)
Enzymes [BR:oll01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     CW732_06205 (metH)
SSDB
Motif
Pfam: Met_synt_B12 Pterin_bind B12-binding_2 B12-binding
Other DBs
NCBI-ProteinID: AUC75288
UniProt: A0A2K8WX78
LinkDB
Position
1420160..1422832
AA seq 890 aa
MKIKQTKYMKLSGLEPLVLNENSNFINVGERTNVAGSRKFLRLIKNEEFDEALDVARHQV
DGGAQIIDINMDDGLIDGVKSMVRFLNLIAAEPDICRVPIMIDSSKWEIIEAGLQVVQGK
CVVNSISLKEGEEKFIWEAKQIKRYGAAVIVMAFDEVGQADNYDRRIEIAQRSYDVLVNK
VGFPSEDIIFDLNIFPVATGMDEHRRNAIDFIEATRWVRQNLTNASVSGGVSNVSFSFRG
NDGVREAMHSVFLYYAIQAGMNMGIVNPALLEIYDDIPKDLLERVEDVILDRREDATERL
LDFADSVKGSKKEKVADLSWRENPLQDRITHALVKGIDAFIIEDVETARQQADKPIEVIE
GNLMVGMNVVGDLFGAGKMFLPQVVKSARVMKKAVSYLNPFIEAEKGEKQKALGKVLMAT
VKGDVHDIGKNIVSVVLGCNNYEIVDLGVMVSPEKIIAAAIEENVDVIGLSGLITPSLDE
MVYLAKEMERQNFVVPLLIGGATTSKAHTAVKIDTQYKNAVVHVNDASRAVTVVSDLLNP
KTSNLYVAKLKKDYDEFRTKFLKRGKEKSYISIEKAREEKFKIDWEASNIVKPKELGVQT
LTQVSLKGILPFIDWSPFFRSWDLHGKYPNILTDEVVGEQASILFEDAQIILKEIINKQL
LKPKAIFGLFEANTINDDDISIRKKGEEIAVFRTLRQQLKKRVGKPSFALSDFIAPKATG
RPDYMGAFCTAIFGADELAKKYKDKEDDYNAIMVQAIADRFAEGLAEYLHKQVRIKHWGY
GADENLSNDDLIKESYKGIRPAPGYPACPDHLEKETIWDLLKVEEQIGVTLTESLAMWPG
AAVSGYYFANEEAKYFGLGKITDDQVKDFALRKNITLEKARKWLHPNLTD
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgaaaataaaacaaactaaatacatgaaattgtctggtttagaacctttggttttaaac
gaaaacagcaattttataaatgttggagagcgtacaaatgtggcaggttctcgtaagttt
ttacgtttaattaaaaacgaagagtttgatgaagctctggatgttgcaaggcatcaagtt
gatggaggcgcccaaattatcgacattaatatggacgatggtttaattgatggtgtaaaa
tccatggttcgttttttaaatttaattgctgctgagccagatatttgtcgtgtgccaatt
atgatagacagttctaaatgggaaatcattgaggctggattacaagtggtgcaaggtaaa
tgtgttgttaattcgatttcgttaaaagaaggagaagaaaaatttatttgggaagccaaa
caaattaagcgttatggcgcagctgttattgtcatggcttttgatgaagttggtcaagca
gataattacgacagaagaatagaaatagcacaacggtcttacgatgtgttagttaacaaa
gtgggttttccatcggaagatattattttcgatctaaatatatttcctgtagcaacggga
atggatgagcaccggagaaatgcaatcgattttatcgaagcaacacgttgggtgagacaa
aacttaaccaatgcaagtgttagtggtggtgtaagtaatgtctctttttcttttagagga
aatgatggtgtgcgagaagctatgcactcggtgtttttatactatgccattcaagcaggc
atgaacatgggaattgtaaatccggccttgttagagatttacgatgatattccaaaagat
ttattagagcgtgtagaagatgttattttagatagacgtgaagatgctacagaacgttta
cttgattttgcagattcagtgaaaggatctaaaaaagagaaagtagccgatttgtcttgg
agagaaaaccctttacaagatagaattacacatgcattggttaaaggtattgatgctttt
attattgaagatgtagaaacagcaagacagcaagccgataaacctattgaagttattgaa
ggtaacttaatggttggaatgaatgtggttggagacttatttggagcaggaaaaatgttc
ttgccacaagtagttaaatctgctcgtgttatgaaaaaagcagtgtcttatttaaaccct
tttattgaagccgaaaaaggcgaaaaacaaaaagctttaggtaaagtgttaatggcaact
gtaaaaggcgatgtgcacgatattggtaaaaatattgtgagtgttgttttgggttgtaat
aattatgagattgtagacctaggcgtcatggtatctccagagaaaattatagcagctgct
atagaagaaaatgtagatgttataggtttaagtggtttaataacgccatccttagacgaa
atggtgtatttggctaaagaaatggaacgtcaaaattttgttgttccgttattaattggt
ggtgcaacaacgtctaaagcacatactgcagtaaagattgatacgcaatataaaaatgca
gttgtacacgttaatgatgcctccagagctgtaactgtggttagtgatttattaaatcca
aaaacgagtaatttatacgttgctaaacttaaaaaggattatgacgagtttagaaccaag
tttttaaaacgaggtaaagaaaagtcatacatcagtattgaaaaagcaagggaagagaag
tttaaaattgattgggaagctagcaatattgtaaaacccaaagaattaggtgtgcaaacc
ttgacacaagttagtttaaaaggaattttaccgtttatagattggagtccgttttttaga
agctgggatttacacggcaagtatccaaatattttaacggatgaggttgttggcgagcaa
gcctctattttatttgaagatgcgcagattattttaaaagaaattataaacaagcagtta
ttaaaaccgaaagctatttttggtttgtttgaagcgaatactataaatgacgatgatatc
tctattcgtaaaaaaggagaagaaattgctgtgtttagaacgttacgtcagcaattaaaa
aaacgagtaggaaaaccaagttttgcattgtcagattttattgcgcctaaagccacagga
aggcccgattatatgggggctttttgtacggctatttttggtgcagatgagttggctaaa
aaatataaggataaggaagatgactataatgctattatggtacaagctattgcagatagg
tttgctgaaggcttagctgagtatttacacaaacaagtaagaataaaacattggggatat
ggcgctgatgaaaatttatctaacgacgatttaattaaagagagttataaaggtattcgt
ccagcacctggatacccagcatgtccagatcatttagaaaaagaaaccatttgggattta
ttaaaagtggaagagcaaataggcgtaacacttaccgaaagtttagccatgtggcctgga
gctgcggtttctggatattattttgcaaatgaagaagcaaaatattttggtttaggtaag
attacagacgatcaggtcaaagattttgcgctaagaaaaaacatcacattagagaaagct
agaaaatggttacatcctaatttaacagattaa

DBGET integrated database retrieval system