KEGG   Ostreococcus lucimarinus: OSTLU_28559Help
Entry
OSTLU_28559       CDS       T01029                                 

Gene name
CSD1
Definition
(RefSeq) predicted protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:olu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    OSTLU_28559 (CSD1)
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     OSTLU_28559 (CSD1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 5006487
NCBI-ProteinID: XP_001422430
JGI: 28559
UniProt: A4SAG2
LinkDB All DBs
Position
19:complement(join(73811..73852,73997..74489,74615..74673))
Genome map
AA seq 197 aa AA seqDB search
MQTLSRSATLASKTHLCGAKSTKTSAHRPRAVAVTAEQKQAVCVLTGTAGVSGVLKLSQS
GDAPTKVVGSITGLAPGKHGLHIHEFGDTTNGCMSTGPHFNPNKMDHGAPTDATRHAGDL
GNVEATAGGCDFVIEDSQIPLSGANSIIGRAFVIHELEDDLGKGDSSEIGTQGKTSKTTG
NAGARLACGVLALAPSA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgctctcccgatcggcgacgctcgcctccaagacccacctctgcggcgccaag
tcgacgaagacgtccgcgcatcgccctcgcgcggtcgcggtgacggcggagcaaaagcag
gcggtgtgcgtgctcacgggcaccgcgggggtgtcgggcgtgctcaagctgagccagagc
ggcgacgcgccgacgaaggtcgtcggctccatcaccggactcgcgccgggcaagcacggc
ctgcacattcacgagttcggcgatacgacgaacgggtgcatgtccacgggaccgcacttt
aacccgaacaagatggatcacggcgcgccgacggacgcgacgcgacacgcgggcgacctc
ggcaacgtcgaggccaccgcgggcgggtgcgacttcgtcatcgaggactcgcagattccg
ctgagcggggcgaactcgatcatcggacgcgcgttcgtgattcacgagctcgaggacgat
ctcggcaagggcgatagctctgagatcggcacccagggcaagacgtcgaagacgacgggc
aacgccggagcgcgcttggcgtgcggcgtcctcgcgttggcgccctccgcgtga

DBGET integrated database retrieval system