KEGG   Ostreococcus lucimarinus: OSTLU_29304Help
Entry
OSTLU_29304       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00020  Citrate cycle (TCA cycle)
olu00190  Oxidative phosphorylation
olu01100  Metabolic pathways
olu01110  Biosynthesis of secondary metabolites
olu01200  Carbon metabolism
Module
olu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
olu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
olu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    OSTLU_29304
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    OSTLU_29304
Enzymes [BR:olu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     OSTLU_29304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_binding_3 Thi4 GIDA Serglycin
Motif
Other DBs
NCBI-GeneID: 5006691
NCBI-ProteinID: XP_001422453
JGI: 29304
UniProt: A4SAL7
LinkDB All DBs
Position
20:22535..24436
Genome map
AA seq 633 aa AA seqDB search
MRACERGCVAARNALTTSASGSGSGSGSGRSIATAASSSTSSYEIIDHEYDALVVGAGGA
GLRAAIGLGEHGFKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGADW
LGDQDAIQYMCREAPKAVIELEKYGMPFSRTDEGKIYQRAFGGQSLDYGKGGQAYRCAAA
ADRTGHAMLHTLYGAALKHDVQFFVEYFALDLIMDKGECVGIMALCLEDGTLHRFRSHQT
ILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDQEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPSAKDLASRDVVSRSMTLEIREGRGVGKEKDHIYLHLNHLP
PELLAERLPGISETAAIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKGEVVAPKNGDPDAI
VPGLLAAGEAACASVHGANRLGANSLLDIVVFGRACANTVADKLKRGAPHREIASDAGSN
AIERLDKIRNSKGSAPTAMLRKTMQKVMQEDAAVFRTQETLANGCKRIDDVAAQLDNLKL
TDRSLVWNTDLVEALELHNLMPNAQTTMHSAEQRKESRGAHAREDFPDRLDDVWMKHTLA
YVENGKVKIDYRPNHHYTLDAEMDVIPPKARVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgtgcgagcgaggatgcgtcgccgcgcgaaacgcgttgacgacgagcgcgagc
gggagcgggagcgggagcgggagcgggcgatcgatcgccaccgcggcgtcgtcgtcgacg
tcgtcgtacgagatcatcgatcacgagtacgacgccctggtcgtcggcgccggcggcgcg
ggcttgcgcgccgcgatcgggctcggcgagcacggattcaagacggcgtgcgtcacgaag
ttgttcccgacgcgatcgcacacggtggcggcgcagggagggatcaacgcggcgctaggg
aacatgaccgaggacgactggcggtggcacgcgtacgacacggtgaaaggggcggattgg
ttgggagaccaagacgcgattcaatacatgtgtcgcgaggcgccaaaggcggtgatcgag
ttggaaaagtacgggatgccgttttcacgaacggacgaggggaagatttatcaaagagcg
ttcggaggacaatcgctggattacggcaagggcggtcaggcgtatcgatgcgccgcggcg
gctgatcgaacgggacacgcgatgttacacacgctctacggcgcggcgttgaagcacgac
gtgcaattcttcgtggagtatttcgcgttggatttgatcatggacaaaggcgagtgcgtc
ggaatcatggctctgtgccttgaagacggcacgttgcaccgattcagatcacaccagacg
attttagccaccggaggttacggcagagcgtactttagcgcgacgtcggcacacacgtgc
acgggcgacggcaacgccatggtggcgcgcgcgggtttgccgttacaagatcaagaattc
gtgcaatttcacccgactgggatttacggcgccggatgcttgatcaccgaaggttcgcgc
ggcgaaggcggaatcttgcgcaactcggagggcgaacgtttcatggagcgctacgccccg
agcgccaaggatctcgccagtcgcgatgtcgtctcgcgatcgatgacgctcgagattcgc
gaaggacgtggtgtcggtaaagagaaagatcacatctacttgcacttgaaccacttgcct
ccggagctattggcggagcgccttccggggatttcggaaaccgccgcgattttcgccggc
gtcgacgtcaccaaggagccgatccccgtcatccccaccgtgcattacaacatgggtggt
atcccaaccaactacaagggcgaagttgtggcacctaagaacggagacccggacgccatc
gtccctggcttgctcgccgccggcgaggcggcgtgcgcgagcgtgcacggcgccaaccgt
ttgggtgccaactcattgctcgacatcgtcgtcttcggtcgcgcgtgcgctaacacggtg
gctgataaactcaagcgcggtgcaccgcatcgtgagatcgccagcgacgccggatcgaac
gccatcgaacgtttggacaagattcgaaactccaaaggcagcgcgccgacggcgatgctt
cgtaagacgatgcaaaaggtgatgcaagaggatgccgcggttttccgtactcaagaaacg
ctcgcaaacgggtgcaagcgtatcgacgacgtcgcggcgcagctggacaacttgaagctc
accgaccgatcgttggtgtggaacactgacttggtcgaagcgctcgaacttcacaacctc
atgcccaacgcgcagacgacgatgcactcagccgagcaacgcaaggaaagccgtggtgcg
cacgcccgcgaggatttccccgaccgtttagacgacgtgtggatgaagcacacgctcgcg
tacgtggaaaacggcaaggtgaagattgattaccgtcccaaccaccactacaccctcgac
gccgagatggacgtaattccgcccaaggcgcgcgtgtactaa

DBGET integrated database retrieval system