KEGG   Ostreococcus lucimarinus: OSTLU_36075Help
Entry
OSTLU_36075       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00500  Starch and sucrose metabolism
olu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:olu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    OSTLU_36075
Enzymes [BR:olu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     OSTLU_36075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amyl_C2
Motif
Other DBs
NCBI-GeneID: 5000144
NCBI-ProteinID: XP_001416368
JGI: 36075
UniProt: A4RT60
LinkDB All DBs
Position
2:complement(join(318845..319095,319120..320212))
Genome map
AA seq 447 aa AA seqDB search
MDEVEVAVSACTVKEAKCSTCKTGYSDVVLLQAFDWLSTKRSLHSDKSYYRRIEDRVPMI
ADFGFTHVWLPPPSLSVDEHGYMPSEIYNLDGSEYGDEAELKSLVQALKKAGIVAVCDIV
INHRCAEYASDGRFISFADEVTPSGRRINWGAYAIVGDDPFFREGQGANDSGDSIEIAPD
LDHTNAEIREAIIEWLNWLKDDIGFSGWRFDFVQGYAPNFVREYVEKTVGFEQFCVGENW
VGMTWSGSFLEYNQDKPRRVLVDWLNAADECAALFDFVTKGILQEAVKRVEFWRLRDQQG
GMPGLAGWVPQSAVTFLDNHDTGYPQNHWPFPLDRLGLGYAYTLLHPGIPCVFGPHIWCC
DENLEIRALLSCRKLANVCCESRVDIKIAESDLYVAVIDDKIIVKLGPRYDVPGEILAQI
AEFELATHGDDYAVWIRKELLEQPFEE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggtagaagtcgcggtgagcgcgtgcacggtgaaggaggccaaatgctcgacg
tgtaaaactggttacagtgacgtcgtgcttttacaagcattcgattggttgtcgacgaag
cgttcgttacacagcgacaagtcttactatcgcagaattgaggatcgagtgccgatgata
gcggatttcgggtttacgcacgtttggttgcctccaccgtcgttatcggtagacgagcac
ggttacatgccatcggaaatttacaacttggacggtagcgagtacggcgatgaagcggag
cttaaatcgttggtacaggctctgaaaaaagccggaatagtagccgtgtgcgacatcgtc
atcaaccatcgttgcgctgagtacgcttcggatggccgcttcatctcgtttgcggacgaa
gtaacgccgagcgggagacgaataaattggggagcttacgccatcgtcggcgacgatcca
ttttttcgcgaaggtcaaggagccaacgatagtggcgactcgatcgaaatcgcccctgat
ctcgaccacacaaacgccgagattcgcgaagcgatcatcgagtggttgaactggttgaaa
gatgacatcggtttcagcggatggaggttcgatttcgtccaaggctacgctccgaatttc
gtgagagagtatgtggagaaaacggttggatttgagcaattctgcgtcggcgagaactgg
gtcgggatgacgtggtcgggaagctttctcgagtacaatcaagacaagccgagacgcgtg
ctcgtggattggttgaacgccgcagacgaatgcgcggcgttgttcgacttcgtgaccaag
ggaattctacaagaagcagtcaagcgagtagagttttggcggctacgagaccagcaaggc
ggcatgcctgggcttgccggctgggtaccgcaaagtgctgtgacatttctcgacaaccac
gataccggatacccgcagaatcactggccgtttccactcgatcgtctcggtttgggttac
gcgtacacgcttctgcatcccggcattccctgcgtgtttggcccgcacatttggtgctgc
gacgaaaacttggaaattcgagctttgttgagctgccgtaagctcgccaacgtgtgctgc
gagagcagagttgacatcaaaatcgccgagagcgatttatacgtcgcggtcatcgatgac
aaaatcatcgtcaagctagggccgagatacgacgttccgggtgaaatactcgctcaaatc
gcagagttcgagctcgcaacgcacggcgacgattacgcggtgtggattcgaaaagagtta
ctcgaacaaccgttcgaggagtga

DBGET integrated database retrieval system