KEGG   Ostreococcus lucimarinus: OSTLU_46693Help
Entry
OSTLU_46693       CDS       T01029                                 

Definition
(RefSeq) predicted protein
Organism
olu  Ostreococcus lucimarinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70 Microtub_bind
Motif
Other DBs
NCBI-GeneID: 5004237
NCBI-ProteinID: XP_001420062
JGI: 46693
UniProt: A4S3A9
LinkDB All DBs
Position
10:complement(53643..56582)
Genome map
AA seq 979 aa AA seqDB search
MPRGTTTTTRAMSGGEAGGATIELEAAAEFAKDEFYTKSFVVKARERVEASVKVRVETNG
VKYKVTVETDMDAEGQDLRMHWGVATSKETWDNMETPPVKIRPPFTIETTGVCQTRMTPT
SSRLSPTLTATIEGDVADGFYAINFLFKEPKKDRWIHNTNGRDWHVPIPQPPEPELVTRT
ITMLEDYEEEIEEDEEYEEEQEEQELDESLASLSSVVEVNIDLNARASSPVKEEVVSAAS
SEISEPANAWKRLLTPPVDPKPFDTKDENINALVESLFGAGSNGLTSIKPIAARDEGPPE
DEDSEPELELAKAAPMEKPKTLKTGMRKVKRMVTKSRTITKSIDEPLPVKLVEGPWLTTN
TIEEKLIREKEVSYRVGAVVEKNVEGGGVLVRVEAELPWNIVLHWGIVPRGARADVWTLP
PEQWRPEGSVVGDTGKACETPMKKCENPLSDRIQMSYAELQLGNAPTAMRFVLKENGGEG
RWLDRNGDDFVIPMPEPAYASTTLDLTGERTKEAIDVATAAAFRAAELHLDSMDEVEEKE
LDMNMQVEYEVATPPLSEDDFAPAERIQKPQKSAVGNGREVLLQGFNWESCKAPWYQAVE
RLAPTIAELGFTVVWLPPPTSSVSEQGYMPLDYYNLDSRYGTKEELKGAIKALHDNGVMA
LGDAVLNHRCAHFIGDVPGTYNKFGGKLPWDATAIVADDPNFHGRGNKADGEMFHAAPNI
DHNQAFVKADLEDWMSWLMREVGYDGWRLDYVRGFWGGHVKDYMEATNPQFAVGEYWDSL
AYNMDALDYNQDGHRQRIVNWLNAAGGNAGAFDVTTKGILHAVFERQEYWRLSDKAGKAP
GVMGWWPSRAVTFIENHDTGSTQGHWRFPRDKELQGYAYILTHPGTPTIFWDHIFDNNWG
HLHKPIEDMIRIRKQSGIHCRSEVKIVKCEQSVYAAVIDDRLLMKIGPGHFHADDAWDCV
LSGQDFAIWRKKKDRSQPR
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgagggaccacgacgacgacgcgagcgatgagcggaggagaagcgggaggggcg
acgattgaactcgaagccgccgctgaattcgccaaggatgagttttacacgaaaagtttc
gtcgtcaaggcgcgcgagcgcgtggaagcctctgtgaaagttcgggtcgagacgaatggt
gttaagtacaaggtcaccgtggaaacggacatggacgccgaagggcaagatttgcgcatg
cattggggcgtggcgactagtaaggaaacgtgggataacatggagacacctccagtaaaa
attagaccgccgtttacgattgaaaccacgggggtatgtcaaacgcgcatgacgccgacg
tcgtcacgcttgagccccacgctcacggctacgatcgaaggtgacgtagcggacggcttt
tacgcaatcaacttcctgttcaaagaaccaaagaaagatcgctggattcataacacgaac
ggaagagattggcacgtgccgataccacagccgccggaacctgagttagtgacgcgtacg
attactatgctggaagattatgaggaagagattgaagaggacgaagaatacgaagaggaa
caagaggagcaagagttggacgaatctctcgcctcactttcatcagtggtcgaagtgaac
atcgatttgaacgcgcgcgcgagctctcccgtcaaggaggaagtcgtctcagcagcgtcg
tcagaaatctccgagccggcaaacgcgtggaaacgtcttctaaccccgcctgtggacccc
aagccgttcgacacgaaagacgagaatattaacgccttagttgagtcactttttggcgct
ggttcgaacggtttgacatctatcaagccaatcgccgcgcgagatgaaggaccgcctgag
gatgaggactctgaaccggaacttgaactggccaaagcggctcccatggaaaagccgaag
acgctcaaaactgggatgcgaaaggtgaagaggatggtaacaaagtcccgcactatcact
aagtcgatagatgaaccgctgccggtgaagttggtggagggtccttggctcactacgaac
accattgaagaaaagttgattcgcgagaaagaagtgagttatagagttggcgccgtagtg
gaaaagaacgtcgagggtggtggagtcttggtgcgtgtagaagctgaacttccgtggaat
attgttttgcattggggtattgttcctcgcggcgcgcgtgcggatgtttggacgttgcct
ccggaacaatggcgcccagaaggttcagtggtcggggacacgggcaaagcgtgcgagact
cccatgaagaaatgcgagaacccgctgtccgatcggattcagatgagttatgcggagctt
cagctcggaaacgcacccactgcgatgcggtttgttctcaaagaaaatggtggagaagga
cggtggcttgatcgcaatggcgacgattttgtcattcccatgcccgagccggcgtacgca
agcaccacgctcgatctcactggtgagcggactaaggaagcgatagacgtcgccacagcc
gctgcgtttcgtgcggcggagttgcatctcgactccatggatgaagtcgaagagaaggag
cttgatatgaatatgcaagtcgagtacgaggtggcgactccaccactgagcgaagacgac
tttgctccggcggagcgaattcaaaagcctcagaaatcagccgtcggtaacggtcgggaa
gttttgcttcaaggcttcaactgggagtcttgcaaggctccatggtaccaagccgtcgag
cgacttgcacccaccattgcggaactaggattcacggtggtttggttgcctccgccgaca
tcgagcgtcagcgagcaaggttacatgcctctggattattataacttggactctcgatac
ggcacaaaggaagaattaaagggcgccatcaaggctttgcacgataatggtgtgatggcg
ctcggtgatgccgtgcttaaccatcgatgcgcccatttcataggcgacgtacccggcacg
tacaacaagtttggaggcaagttaccgtgggacgcgacagccatcgtggcagacgatccc
aattttcatggccgaggaaacaaagccgatggtgaaatgttccatgcagctcctaatatc
gaccataatcaagctttcgtcaaggctgatctcgaagattggatgagctggctcatgcga
gaagtcggctacgacggttggcgactcgattacgtgagaggtttctggggtggtcacgtg
aaggattacatggaggcgacgaatccgcagttcgcggtcggtgagtactgggattcgttg
gcctataacatggatgctctggattacaaccaagatggtcatcgacaacggatcgtgaac
tggctcaacgccgccggcggaaacgccggcgcgttcgacgttaccaccaagggcatcctg
cacgccgtatttgaacgccaagagtattggcgcttatcggataaagcaggcaaggctccg
ggtgtcatgggttggtggcctagtcgagcggtgactttcatagaaaatcacgacactgga
tcgacgcaaggccactggcggtttcctcgcgacaaagagcttcaaggatacgcgtacatc
ctgacccacccgggcacgccgacaatcttctgggatcacatctttgacaacaactgggga
catttgcacaaacccatcgaagacatgattcgtattcgcaaacagtccggtattcactgc
cggagcgaagtgaaaatcgtcaagtgcgagcagagcgtgtacgccgccgtcatcgatgac
cgacttttgatgaaaattggacctggtcattttcatgcagacgacgcgtgggattgcgtg
ctttctggacaagactttgcaatctggcgcaagaagaaagatcgttcgcagccgcggtga

DBGET integrated database retrieval system