KEGG   Ostreococcus lucimarinus: OSTLU_51006Help
Entry
OSTLU_51006       CDS       T01029                                 

Definition
(RefSeq) predicted protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
olu  Ostreococcus lucimarinus
Pathway
olu00620  Pyruvate metabolism
olu00710  Carbon fixation in photosynthetic organisms
olu01100  Metabolic pathways
olu01200  Carbon metabolism
Module
olu_M00168  CAM (Crassulacean acid metabolism), dark
olu_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:olu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OSTLU_51006
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    OSTLU_51006
Enzymes [BR:olu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OSTLU_51006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 5004725
NCBI-ProteinID: XP_001420862
JGI: 51006
UniProt: A4S610
LinkDB All DBs
Position
12:complement(480026..483049)
Genome map
AA seq 1007 aa AA seqDB search
MLKAVFSGKDKAKITSHKRTGSLFASEEGEALDALARSSSYLSGRGETKEFNAHDVIEEC
DELLRTIFFAVVRETAGDKFLGQLKSVYEASEKFGSSHDPKDFDAMQAMLETMEVDESLQ
FASAYSNLLNLHNISEQVANAMEERHRRLDDIPRGPAKTTNGAIKGLLRAGKSTEEIYSA
LAVQHVDLVLTAHPTQALRRSMLKSFGIIREKLLQLQRFRLSRYERAEVLDEIRSKVASA
WRTDEIRRTPPKPQDEMRAGLTYFQQTIWDGIPTFMRRVDTSLLANGCPRLPLDRSIVTF
GSWMGGDRDGNPYVTASCTRDVVLLARVQGVNLLFRAIQRLIFDLSMWRCNDAVKALAKD
ILENSETDNFTIFEERKKRNYDDFWKAIPEHEPYRVILAELRDKLYNTREALQRCIADND
VNIDMNDETIIRSKDELFAPLVVCYESLIEVGDAQIANAYLLDVIRQVQCFGLGLVKLDI
RQESDRHAEALDAVTRYIGLGSYLEWSEEQKIEFLTRELESKRPLLPSDLECSDDVREVL
DTCKMIAHLQQTCPGALGTYVISMATSASDVLAVVLLQRECGCRKQDLLRVAPLFERLDD
LNDAPRVLRQLFSVKWYHDHIAGFQEVMIGYSDSGKDAGRMAAAWALYDGQERVVAAGKE
FDVALTLFHGRGGTVGRGGGPAHIAMLSQPPGTVNGSIRVTVQGEVIETDFGEKENCFHT
LDLYTASVLEHTLKPPAHPRDEWRRVMDRMSEYSCAHYRKTVFETPDFVGYFAQATPGAE
LGSLNIGSRPAKRKPSAGVTALRAIPWIFAWTQSRFHLPVWLGISTSFRRLIDEGELETL
RDMYKSWPFFEVTIDLVEMVLAKADPVVVAYYERALVDPKLHDFGASLRGELQESIDCIL
AVSEHIGLLAKPEKVEANEAVQVHKKLAHKLHKRSLYITPLNVCQVRYLIAARALENEED
GDKLSMQKVKITLLEGYPFQDYNYKGAVNDVLKITMKGIAAGMQNTG
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaggcggtgttcagtgggaaggataaggcgaagataacgtcgcataaacggacg
gggtcgttgttcgcgagcgaggagggcgaggcgctggacgccctggcgcggtcgtcgagt
tatctgagcggtaggggagagacgaaggagttcaacgcgcacgacgtgattgaggagtgt
gatgaactgcttcggacgatcttcttcgccgtggtgagggagacggcgggagataagttt
ttggggcagttgaagagcgtgtacgaggcgagcgaaaagtttggcagctcgcacgacccg
aaggatttcgacgcgatgcaggcgatgttggagacgatggaagtggatgaatcgttgcag
ttcgcgtcggcgtactcgaatctgttgaatctgcacaatatttccgagcaagtggcgaac
gcgatggaggaaagacacagacgtttggacgatattccgcgagggccggcaaagacgacg
aacggcgcgattaaaggtttgcttcgagccgggaagtcgacggaggaaatctacagcgct
ttagcggtgcagcacgttgatttagtgctcaccgcccaccccacgcaagccttgagacgg
tcgatgttgaaatctttcggaataattcgtgaaaagctgttgcagctgcaacgatttcgc
ctttcgcgatacgagcgtgcagaagttttggacgagattcgatcgaaggtcgcctcggcg
tggcgcacagatgagatccgccgcacgccaccgaagcctcaagacgaaatgcgcgcgggt
ctgacgtactttcagcaaaccatctgggatggcatcccaactttcatgcgtcgcgtggac
acgtcgctcttggcaaacggatgccctcgtttgccgctcgacagatccatcgttacgttc
gggtcgtggatgggtggtgatcgtgacggcaacccatacgtcacggcatcatgtacgcgc
gacgtcgttctcttggcccgtgtgcaaggggttaacctactcttccgagcgattcagcgt
ctgattttcgatttgtccatgtggcgatgcaacgacgccgtcaaggcgttggcaaaggac
atcttggagaactcggaaacggacaactttacgatcttcgaagagcgcaagaagcgaaac
tacgatgacttttggaaggccattcccgagcacgagccttaccgcgtcatcttggctgaa
cttcgagacaagctttacaacacgcgagaggcgttgcagcgttgcatcgcggacaacgac
gtcaacatcgacatgaacgacgagactatcattcgttccaaggacgaactgttcgcaccc
ttggtggtgtgctacgagtctctcatcgaagtcggtgacgctcaaattgccaacgcctat
cttctcgacgtcattcgccaagtgcagtgctttgggttggggctggtcaaactcgatatc
cggcaagaatctgatcgccacgccgaggctttggacgcggtgaccaggtacatcggcctc
ggatcgtacctcgaatggagtgaggaacagaaaattgagttcctgacacgcgagcttgag
agcaagcggccacttttaccttccgacctcgaatgctcggacgacgttcgagaagtcctg
gacacgtgtaagatgattgcgcacttgcaacaaacgtgcccgggtgccctcggaacgtac
gttatatccatggcgacaagtgccagcgatgttttggcagttgtattattacagcgcgag
tgtggctgtcgcaaacaggatcttcttcgcgttgcaccgctctttgagcgactcgacgat
ctgaacgacgccccgcgcgtgttgcgccagctcttctccgtgaagtggtatcacgaccac
atcgcgggattccaagaggttatgatcgggtattcggatagtggaaaagacgctggtcgc
atggctgcagcatgggcgctgtacgatggtcaagaacgcgtcgtggcggcagggaaggag
tttgacgttgcgctcaccctgtttcacggtcgcggaggcaccgtaggtcgcgggggaggt
ccagcgcacattgccatgttgtctcagcctccaggcactgtgaatggtagcatcagagtc
accgtgcaaggagaagtgatcgaaaccgacttcggtgaaaaagaaaactgttttcacact
ctggatttgtacacggcgtccgttctggagcacacgttgaagccgccggcgcatcctcgc
gatgaatggcgccgagtcatggatagaatgagcgaatactcatgcgcgcattatcgtaag
actgtgttcgaaacccctgatttcgtcggatactttgcacaggccacgcctggagccgag
cttggatcgctcaacatcggttctcgaccggccaagcgtaaaccgagtgcgggcgtcacc
gctcttcgagcaattccgtggattttcgcgtggacgcagtcgcgattccacttgccagtc
tggctcggaatttccacatcattcagacgcttgatcgacgaaggcgaactggaaacgctg
agggacatgtacaaaagttggcctttctttgaggtgacgatcgatttagtggagatggtg
ctcgccaaggcggatcccgtcgtcgtggcgtattacgaaagagcccttgtcgatccaaaa
ttgcacgacttcggcgccagtctgcgcggcgagcttcaagaaagcatcgattgcatcctc
gccgtctccgagcatatcggtttgctcgccaaaccagaaaaagtcgaggcgaacgaggcg
gttcaggtgcataaaaagctcgctcacaaacttcacaagcggtcgctgtacatcacgccg
ctcaacgtgtgtcaagtgcgatatctcatcgccgctcgcgcgcttgaaaatgaagaagat
ggcgataagctaagcatgcaaaaagtcaagatcaccttgctcgagggttacccgttccaa
gattacaattacaagggcgcggtgaacgacgttttaaaaatcacgatgaagggcatcgca
gccgggatgcaaaacactgggtga

DBGET integrated database retrieval system