KEGG   Oleiphilus messinensis: OLMES_0684Help
Entry
OLMES_0684        CDS       T04860                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ome  Oleiphilus messinensis
Brite
KEGG Orthology (KO) [BR:ome00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ome03012]
    OLMES_0684
   03029 Mitochondrial biogenesis [BR:ome03029]
    OLMES_0684
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ome04147]
    OLMES_0684
Translation factors [BR:ome03012]
 Eukaryotic Type
  Elongation factors
   OLMES_0684
 Prokaryotic Type
   OLMES_0684
Mitochondrial biogenesis [BR:ome03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    OLMES_0684
Exosome [BR:ome04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OLMES_0684
  Exosomal proteins of breast cancer cells
   OLMES_0684
  Exosomal proteins of colorectal cancer cells
   OLMES_0684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ARU54776
UniProt: A0A1Y0I4S4
LinkDB All DBs
Position
744783..745976
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAALTRVCAEVWGGEAIAFDGIDNAPEERERG
ITIATSHVEYDSPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDEELLELVEMEVRELLDQYEFPGDDTPIIIGSALMALE
GKDDNGMGTSAVKKLVETLDEYIPEPERAVDQAFLMPIEDVFSISGRGTVVTGRVERGII
RVGEEIEIVGIKDTTKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEVERGQVLAKPG
TINPHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGSCELPEGVEMVMPGDNV
RMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVSKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaagaaaaatttgaacgcaccaaaccgcatgtaaacgttggaactatcggtcac
gtagaccatggtaaaacaactttgactgcagctttgactcgtgtttgtgcggaagtttgg
ggtggtgaagcgatagcatttgacggtatcgataacgcgcctgaagaaagagagcgtggt
attaccatcgcaacttctcacgtagagtatgattctcctactcgtcactacgcgcacgta
gactgccctggacacgcggattatgttaaaaacatgatcactggtgcggctcagatggat
ggtgctatcctggtatgttccgcggctgacggccctatgcctcagactcgtgagcacatc
ctgctgtctcgacaggttggtgtaccgtacatcgttgtgttcctgaacaaagctgacatg
gtagacgatgaagagttgttggagttggtagaaatggaagttcgtgagctgttggatcag
tacgaatttcctggagacgacactccaatcatcatcggttctgcattgatggcgttggaa
ggtaaagatgataacggcatgggtacttctgctgttaagaagctggttgagactcttgat
gagtacattccagagccagagcgtgcagttgatcaagcgttcctgatgccaatcgaagat
gttttctctatctctggtcgtggtactgttgttaccggtcgtgtagagcgtggtatcatt
cgagttggtgaagagatcgaaattgttggtatcaaagatactaccaaaacgacctgtact
ggtgttgagatgttccgtaagctgcttgacgaaggtcgtgcaggtgagaacgttggtgtt
ttgttgcgtggtactaagcgtgatgaagttgagcgtggccaggttctggctaagccagga
accatcaatcctcacactaaattcgaaagtgaagtttatgtgttgagcaaagatgaaggt
ggtcgtcatactccattcttcaaaggctatcgtccacagttctacttccgtactactgat
gtgactggttcttgtgaactgccagaaggtgtggaaatggtaatgccaggggacaacgtt
cgaatggttgttactctgattgcgcctatcgcaatggaagatggtctgcgcttcgcgatt
cgtgaaggtggccgtaccgttggtgctggtgttgttagtaaaatcatcgaataa

DBGET integrated database retrieval system