KEGG   Oleiphilus messinensis: OLMES_1256Help
Entry
OLMES_1256        CDS       T04860                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ome  Oleiphilus messinensis
Pathway
ome00620  Pyruvate metabolism
ome00680  Methane metabolism
ome01100  Metabolic pathways
ome01120  Microbial metabolism in diverse environments
ome01200  Carbon metabolism
Module
ome_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ome00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OLMES_1256
  09102 Energy metabolism
   00680 Methane metabolism
    OLMES_1256
Enzymes [BR:ome01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OLMES_1256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ARU55338
UniProt: A0A1Y0I4A7
LinkDB All DBs
Position
1413628..1416276
Genome map
AA seq 882 aa AA seqDB search
MSELHPGLRENVKLLGELLGQSIRDHLGEPFLDKVEAIRTAAKAGRKQQDSRNEKLLALL
SQLQDSEVLPVTRAFNQFLNLANIAEQYHGIRRNQTTGIGGDIESLESVFARLKESGISG
DAIFEMAQRMKIEFVLTAHPTEVTRRTLIMKYDALTECLEQLDRTDLADDEYERIVSRLA
QLVAQAWRTDEIRHDRPTAEDEAKWGFAVIENSLWHALPRFLRSLDKALLDACGKKLPLS
AAPIKIASWMGGDRDGNPNVTADVTRNVFMLSKWMAADLYLRDIEVLRAELSMNEASSEL
YREAGTRHEPYRVVLAKLRDRLLSLRDQLQASLESASGTSFPPSEQDWVTTQDVIDTLEL
CYRSLVAKGMGLIADGGLQDTIRRAYCFGMELVKLDIRQESTRHMQAIDEVTQYLGLGSY
ADWSEDDKIAFLIRELSGRRPLIPARWQASAETEEVLRTCRVVAAQPPEALGSYVISMAG
KVSDVLSVILLLRESGVSHAMRIVPLFETLTDLDNAPGCIDHLLSLPWYRDYCAGVQEVM
IGYSDSAKDAGQMMAAWAQYQAQEKLVAVAGQHGVRLTLFHGRGGTVGRGGGPANRAILS
QPPGSVDGSFRITEQGEMIRFKFGLPKLALQSMTLYSSAVLEASLLPPPQPEPQWREMMN
YLTSRSLDGYRDTVRGNADFVTYFRQATPEQELGKLALGSRPAKRKASGGVESLRAIPWI
FAWTQMRLMLPAWLGADVALEAALKDGHEDLLREMAQRWPFFNTHIDMLEMVVAKSDATI
SNYYERRLASEELHVLGQTLRERLARVTGLVNRLKQQANLLDDNPLFRQSLDVRNPYTDP
LHYLQAELLYRVRHHPAENADEVEEALKVTMAGIAAGMRNTG
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaactacaccctggtttgcgggaaaatgtgaaactgctcggggaacttcttggg
cagagtattcgtgatcacctcggggagcccttcctcgataaagttgaagctattcgcacg
gctgcgaaagcgggacgaaaacaacaagatagtcgcaatgagaaattgctggcgctgttg
agtcaattacaggattcagaagtgctgccagttacgcgtgcctttaatcagtttttgaac
ctcgccaatattgccgaacagtaccatggtattcgacgtaatcagacaacgggtatcggt
ggtgatattgaatcactggaatctgtgtttgcccggttgaaagagagcggtatatccggg
gacgctatttttgaaatggcgcagcgcatgaagatcgaatttgtcctgactgcgcacccg
acggaggtcacccgtcgtaccctgattatgaaatatgacgccctcaccgagtgtctggaa
cagttagatcgaaccgacctggctgatgatgagtatgagcgtatcgtgagtcgattagcg
cagttggttgcccaggcatggcgtactgatgaaattcgtcatgaccgtcccaccgcagaa
gatgaagcaaaatggggcttcgcggtgattgagaacagcctttggcacgcgctaccccga
ttcctccgttccctggacaaggcccttctggatgcctgtggtaaaaaactgccattatcc
gctgcaccgataaaaattgcctcctggatggggggcgaccgggatggtaatccaaatgtg
acagcggatgtgacccgcaatgtgtttatgttaagcaagtggatggccgcggatctctat
ttgagagatatcgaggtactgcgcgcagagctctcgatgaatgaagcatcctcagaattg
tatcgggaagccgggacaaggcacgaaccgtatcgggtggtactggccaagctgcgggat
cgcctgttatcgcttcgtgatcagttacaggcatcgttagaatccgcgtccggcacttcg
tttcccccctcagagcaggactgggtcaccacacaagacgttattgacaccctggagttg
tgttatcgctcgctcgttgccaagggaatggggctgattgccgatggtggtttacaggat
acaatccggagagcctactgctttggtatggagctggtgaagctggatattcgccaggag
tccacccggcacatgcaggcgattgatgaggtcacacaatatctggggctggggtcttat
gccgattggagcgaagacgataagatcgcatttctgattcgtgaattgagtggtcgcagg
cctctgataccagcccgatggcaagcctcggcggagaccgaggaagtcttgagaacttgt
cgggtcgtagcggctcagccgcccgaagcattgggatcctatgtaatctcaatggccggg
aaggtatccgatgtgttaagtgtcattctgcttttgcgggaaagcggtgtcagccatgcc
atgcgtattgtgccattgttcgagacactaaccgatttggataatgccccgggatgtatt
gaccacttgctttctttgccatggtatcgggattattgtgccggagtgcaagaggtgatg
atcggttattctgattcggcaaaagatgccggtcagatgatggcggcctgggcgcaatat
caggctcaggaaaaactggttgcggtggccgggcaacatggggtcaggttaactctgttt
catggtcgcggggggactgtggggcggggtggcggtccggctaatcgggctattttgtcg
caaccaccggggtctgttgatggttctttccgtattactgagcaaggggaaatgatccgg
ttcaagttcggcctgccaaaactggcactacaaagtatgacgctttatagttccgcggtg
ctggaagcttcgctactaccgcctccccagccagaaccacaatggcgggaaatgatgaat
tacttaacatcccgttccctggatggttatcgggatacggtcagaggtaatgctgatttc
gtgacctacttccgtcaagcaaccccggaacaggaactgggtaagctggctttgggcagc
cgcccggcgaagcgtaaagccagtggcggcgtggagagcttgcgggcgattccgtggatt
ttcgcctggacccaaatgcgtttgatgttaccggcctggctgggagctgatgtcgccctg
gaagcggccttgaaggatggtcatgaggatctcttgcgggagatggcgcagcgctggccg
ttttttaatacgcacatcgatatgctggaaatggtggttgcgaaatccgatgccactatt
tctaactattatgagcggcgattggcatctgaggagctgcatgtattggggcagacgctg
cgggaacgactggctcgtgtaacgggtctcgtcaatcgtttgaaacaacaggcgaatctg
ctggatgacaatccattgtttcggcaatcgctggatgtgcgcaacccctatactgatcct
ttgcattatctgcaggcggaactgttgtatcgggtacgtcatcatcctgccgagaatgct
gatgaagtggaagaggcgctgaaagtgaccatggcggggattgctgcgggcatgcgcaat
accgggtag

DBGET integrated database retrieval system