KEGG   Oleiphilus messinensis: OLMES_3460
Entry
OLMES_3460        CDS       T04860                                 

Gene name
rlmL
Definition
(GenBank) SAM-dependent fused 23S rRNA m(2)G2445 and m(7)G2069 methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
ome  Oleiphilus messinensis
Brite
KEGG Orthology (KO) [BR:ome00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ome03009]
    OLMES_3460 (rlmL)
Enzymes [BR:ome01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     OLMES_3460 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     OLMES_3460 (rlmL)
Ribosome biogenesis [BR:ome03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    OLMES_3460 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 Methyltransf_31 THUMP Methyltransf_25 Methyltransf_11 PrmA Methyltransf_12 Methyltransf_23
Other DBs
NCBI-ProteinID: ARU57496
UniProt: A0A1Y0ICJ1
LinkDB
Position
complement(3921978..3924200)
AA seq 740 aa
MSDQIIYVTCPKGVEYLLEEELKALGLSIVKVTPFGVYVGDFQSRSEAINAAYKVCLWSR
IANRVMWILLEAPCDTADQLYSAVHSVAWEQEFDIEKSFSVRFTGTNRQIKNTLFAAQKV
KDAVVDRFRDKLGDRPNVSGKNPDIFISGHLNRGKLTLALDLSGSSLHQRGYRENAGKAP
LKENLAAAVIRRADLARFWEKELNLQEKSVQEIKSICIADPLCGSGTLLIEAAMMALNLA
PGLLRKHFGFTHWKGHDPAVWHALIEHAKTDRIPAETLRGRIRFSGSDIDAQVVSTAKDN
AEKAGVAELVTFSVLQAENWTVAPDTEVLCMITNPPYGERLGEVKALENLYRAIGENLHG
QDVAEKWWYLFTSNPDLSRQTRWRADKTYKFMNGALPCVLYCFSLRDENYLDPSKARALR
GQNWKVSHPERAAMLVNRLKKNQKLLKKWLVSEGIQCYRWYDADMPEYSVAIDLYQDWYH
VQEYVAPASVSVESARERFFEVLSVLRDEFSVNPQKIIYKRRSRQSGATQYQKISDESAV
FDVNEYGVRLEVNLTDYLDTGLFLDHRPIRHWIQQNAKGKSFLNLFCYTGAVTAHAVKGG
ASRTVSVDMSNTYIEWAKRNLQKNTAEVRQHEFIRDDCFAWLKACKERFDLIFLDPPTFS
NSKKMSGILDIQRDHSGLIDQCVSLLNPGGVLIFSNNLRKFKLDEGLRSRYQVVDITKRS
IDRDFLRNTRIHNCWDIRRA
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgtctgatcaaatcatctacgtaacttgtcctaagggtgttgagtatcttcttgaggag
gaattgaaagcgttggggctttcaatcgtaaaagttacaccctttggtgtttacgttggc
gattttcagtccagatcggaagctattaatgcagcttataaggtctgtttgtggtcacga
attgccaatcgtgtcatgtggattctattggaggcaccgtgtgatactgcagaccagctt
tattcagcggtgcattcggtagcatgggagcaagagtttgacatcgaaaaatcgttttct
gtgcgttttaccgggacaaaccggcaaatcaaaaatacactttttgccgcacaaaaggtc
aaagatgctgtcgtagatcgtttccgtgacaagcttggtgacaggccaaatgtttcaggc
aaaaacccggatatctttatatcgggccatcttaatcgggggaagttaacccttgctctt
gatctttccgggtcgagtttgcatcaaaggggatatcgagaaaacgctggaaaagcacca
ttaaaggaaaatcttgcggcagcagttattcgtcgcgcggatttggctcggttttgggaa
aaagaattgaacctgcaggaaaagtcggttcaagagattaagagtatctgtattgctgac
ccattgtgtggttctggaaccttattaattgaagcggcaatgatggcgttgaatctggcg
ccgggtctgcttcggaaacattttggttttacccattggaaaggtcatgatccggctgtc
tggcatgcattgattgagcatgccaaaaccgaccgtatacccgcggagacactccgcggg
cgtatccgctttagcgggtctgatattgatgctcaagttgtgtctactgcaaaagataac
gcggaaaaagctggtgtggctgagctggtgacgttttcagtgctacaggctgagaattgg
acggttgcgccggacactgaggtgttgtgtatgatcactaatccaccatatggggaacgt
ttgggggaagtgaaggcgctggagaacctttatcgggcaatcggggagaatttgcatgga
caggatgtcgctgaaaaatggtggtatctatttacctcgaatcctgatttatcccggcag
acccgctggcgagcagataaaacgtataagtttatgaatggtgctttaccttgtgtcctg
tattgtttctcgctccgggatgagaactatttggatccatccaaagcgcgtgcgctacga
ggacaaaattggaaagtttctcatcccgaacgtgccgcaatgctggtcaatcgcttgaag
aaaaatcaaaagctattaaaaaaatggctcgtttctgaagggattcagtgctaccgctgg
tatgatgctgatatgcctgagtattcggttgcaatcgatctttatcaagattggtatcac
gtgcaggagtatgttgcaccggcatcggtttccgttgagtctgcaagagagcgttttttc
gaagtcttatcggtattgcgagacgagttttcggtgaatccacaaaaaattatctacaag
cgtcggtccaggcaaagtggcgcgactcagtatcaaaagatttcagacgaaagtgctgtt
tttgatgtcaatgaatacggtgtgcgactggaagtgaatctgacagattaccttgatacc
ggattgttcctggatcatcgccccattcggcactggattcagcaaaacgccaaaggtaaa
tcgtttttaaatttattttgttacaccggggcggtaacagcccatgcggtaaaaggtggt
gcttccagaacggttagcgtggatatgtctaacacgtatattgaatgggccaagcgtaat
ctgcaaaaaaatacggcagaggtacgccagcacgaattcattcgagatgattgttttgcg
tggttaaaggcttgcaaagagcggtttgatttgatctttttggatccgccgacattctct
aactccaagaaaatgtccggaatccttgatattcagcgggatcatagcgggttgatagat
caatgtgtcagtcttctgaacccgggaggagtattgatattttccaacaatttgcggaag
ttcaaattggatgaagggttgcgctcacgatatcaggtagttgatatcaccaagcgcagt
attgatcgtgattttcttcgtaataccagaattcataactgctgggatatcagaagggca
taa

DBGET integrated database retrieval system