KEGG   Oleiphilus messinensis: OLMES_4047Help
Entry
OLMES_4047        CDS       T04860                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ome  Oleiphilus messinensis
Pathway
ome00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ome00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    OLMES_4047
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ome02000]
    OLMES_4047
Enzymes [BR:ome01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     OLMES_4047
Transporters [BR:ome02000]
 Other Transporters
  Pores ion channels [TC:1]
   OLMES_4047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-ProteinID: ARU58065
UniProt: A0A1Y0IF11
LinkDB All DBs
Position
4617531..4618142
Genome map
AA seq 203 aa AA seqDB search
MAITNSKDCNLIFYTNPMSRGQIVRWMLEETGKPYQMEVLEYNASMKDPEYLKINPLGKV
PSIVHNGKVVTECAAICAYLADVFPECGLAPSVTERADYYRWLFFAAGPLEAAVINRTLG
FDVPQVKERMVGYGTYDAAVDTLAKAVTTHEYIAGSEFTAADVYVGSHVIWGQQFGSLPK
SKAFQDYAEKLMQRPAYKAAQEK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcactaactcgaaagactgcaatttaattttctacacgaatcccatgtcccga
ggacagattgttcgctggatgctggaagagactggtaagccctatcaaatggaagtgctg
gaatacaacgcatccatgaaagaccctgagtatttgaagataaacccgctcggaaaggtg
ccgtcgattgtacacaatggcaaggttgtaacggagtgtgcggccatttgtgcatatttg
gcagatgtgtttcccgaatgtggtttggcaccctcggtgactgagcgcgcggattattac
cggtggctctttttcgcagcaggtccgctggaagccgcagtcattaatcgcacgcttggt
tttgatgttccccaggtaaaagagcgaatggtcggctatggcacttatgatgctgctgtt
gatacactcgcaaaagcggttacaacgcatgagtacattgctgggtctgaatttactgct
gcggatgtttacgtcggctctcatgtcatttggggccagcaatttggtagcctgcctaaa
agtaaagcgtttcaagactatgccgagaaactaatgcaacgcccggcatacaaggccgct
caagaaaaataa

DBGET integrated database retrieval system