KEGG   Oleiphilus messinensis: OLMES_4752Help
Entry
OLMES_4752        CDS       T04860                                 

Definition
(GenBank) cysteine sulfinic acid decarboxylase (Csad)
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ome  Oleiphilus messinensis
Pathway
ome00250  Alanine, aspartate and glutamate metabolism
ome00410  beta-Alanine metabolism
ome00430  Taurine and hypotaurine metabolism
ome00650  Butanoate metabolism
ome01100  Metabolic pathways
ome01110  Biosynthesis of secondary metabolites
ome01120  Microbial metabolism in diverse environments
ome02024  Quorum sensing
Module
ome_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ome00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    OLMES_4752
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OLMES_4752
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    OLMES_4752
   00430 Taurine and hypotaurine metabolism
    OLMES_4752
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    OLMES_4752
Enzymes [BR:ome01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     OLMES_4752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS
Motif
Other DBs
NCBI-ProteinID: ARU58741
UniProt: A0A1Y0IE65
LinkDB All DBs
Position
5405100..5406758
Genome map
AA seq 552 aa AA seqDB search
MASRKKTANANLESMYRVFTAPEAPQSTLSQIEDYISKNLAGFLQEHIVAVERDLSEVEK
DFADSGIPDKPMFVSEQAQFLLDKLVSNSVHTAAPSFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPLERQVLGMLHRLIYQHDDAYYAQWMHDPLHALGSMCSGGTVANLTA
LWVARNLAFPEEGGFKGIRREGLTRALLYYGYTGAAVLVSERGHYSLKKAADILGIGHDY
IIPIPTNDQNKMDIDALRNECIRLKKDSIRILSIIGIAGTTETGNVDPLEDIADVAKEFN
AHFHVDAAWGGPTLFSRKFSHLLKGIEKADSVTIDAHKQLYVPMGSGLVLYKNPTSVNAI
EHHAQYIIRKGSRDLGSTTLEGSRPGMALLIHSGLKVIGKDGYELLINQGIEKANLFANL
IEQHPDFELVTPPELNILTYRYCPAEAQAALKVASQEQTNKINQILSRVTKSIQKTQRER
GKAFVSRTRLNPAVYGRSPCVVFRVVLANPLTTPDILTSILEEQRELSAEPGIATELQHL
QTLVSEVRQATT
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagaaaaaaaacggcaaatgccaatctcgaaagcatgtacagggtgtttacc
gcacccgaggccccgcaatcgaccttaagccagattgaagactatatttcgaaaaatctc
gcagggttcttacaagagcacattgtagcggttgagcgggatctttctgaagttgaaaag
gactttgcggattccggtataccagataaacccatgttcgtttctgaacaggctcagttc
ctgctcgataaactggtctccaactcagtccatactgccgcaccaagcttcattggccac
atgacatcggccttgccctatttcatgctgccgctgtcaaaaatcatgattgcgctgaat
cagaacctggtgaaaaccgagacgtccaaggcttttacaccattggagcgtcaggtttta
gggatgttacaccgcctgatttatcaacatgatgacgcctattatgcgcaatggatgcac
gatcctctgcacgcactaggcagtatgtgctccggtggaacggttgcaaatttaacggca
ctttgggtggcacgaaatctggcctttcccgaagaaggtggctttaaaggtattcgccgg
gaaggattgacccgcgcgttgttatactacggttataccggtgcagctgttctggtttca
gaacgggggcattactcactgaagaaagcggccgacattcttggcattggacatgattac
atcatcccgatcccgaccaatgaccaaaataaaatggacattgatgcactgcgcaacgaa
tgcatccgtctcaaaaaagattcgatccgaatcctctctatcattggaatcgcgggaaca
accgagacaggcaatgtcgatccgctggaagatattgccgacgtagccaaagagttcaat
gcccacttccatgtcgatgccgcttggggtggaccgacgctcttttcacgaaagttttcc
catttactaaaaggcattgagaaagcggattccgtcaccattgatgcccacaaacaatta
tatgtgcccatgggcagtggtctggtactttataaaaacccaaccagtgtcaacgcaatc
gaacatcatgcccaatacattattcgtaagggctcacgggatctgggcagcacaacactg
gaaggctctcgacccggaatggcactcttgatccattccggcctaaaggttattggtaaa
gatggctatgagcttctgatcaatcagggcatcgaaaaagccaatctgttcgcaaacttg
atcgaacagcaccctgactttgaattagtgaccccgcctgaacttaacattctgacctac
cgctattgtcccgcagaagcccaggcagcattaaaggtcgccagtcaggaacaaacaaat
aaaatcaatcaaatcctgagccgggtgaccaaaagtatacaaaaaacacagcgggagcgg
ggtaaggcttttgtgtcccgaactcgcctgaatccggcagtgtatggacgatcgccctgt
gttgtcttcagggtcgtactggccaacccgctaaccacgcctgacatcctgaccagcatt
ctcgaggagcaacgggaactgtccgcagaaccgggcatcgctactgaacttcaacacctg
caaacactcgtatctgaagtacgccaggcaaccacctag

DBGET integrated database retrieval system