KEGG   Oscillatoria nigro-viridis: Osc7112_0969Help
Entry
Osc7112_0969      CDS       T02375                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00500  Starch and sucrose metabolism
oni01100  Metabolic pathways
oni01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Osc7112_0969
Enzymes [BR:oni01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Osc7112_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AFZ05533
UniProt: K9VBP5
LinkDB All DBs
Position
1120228..1122786
Genome map
AA seq 852 aa AA seqDB search
MQPIRTFNVSPSLPTILEPLRKLAYNLHWDWNVDTKDLFRRLDRDLWDSSNQNPVLMLGT
ISQERLQEMAEDEGFIAQMNRAAQQLDDYLKNRAWYRKQRGTEQQECYAYFSMEFGLVKA
LPIYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQEGYFSQYLNADGWQQERYPLNDFYNM
PLHPERNPDGSELRIEVDYPGRKVYARIWRVQVGTVPLYLMDTNIEPNSRYDQDITDQLY
GGDKTLRMHQEIMLGIGGVKMLKALGLTVTAYHMNEGHAAFMALERIRMLMEEYHLSFEE
AEQVVVSSSMFTTHTPVPAGFDLFEPDMVMHYLGQYPKMFGLSQDEFLGLGRENTGDLSA
PLNMAILAIKMSSFVNGVAALHGVVSRPMFQGLWPGLPVDEVPITSITNGVHARSCVAKS
TQELYDRYLGPEWEMTRKDDRLWDRLSSIPDEELWRNHERCRSELVVFAREWLQKTLRER
GAAQTEIEHAREALNPKVLTIGFARRFATYKRATLFLRDVDRIMRIMRDKNRPVQFVIAG
KAHPMDIPGKELIRDIVHFIREHETMSSMVFLPNYDINVARMMVSGCDVWLNTPRRPREA
SGTSGMKASMNGLPNLSILDGWWDEADYVRTGWPIGHGEFYEDTKYQDEVEANALYDLME
KEVVPLFYNRDADGIPRGWTEKMKDSIRLNCPFFNTARMVKDYARRAYFPVSDRYHTMTS
DNCAPAKELSHWKKHVLAKWHDIKIEAVDISQDKEVKVNQSIAVKSRINLMGLTPADVQV
ELYQGSVDANGDIVGGVPVVMEYLGEDSHNASLYTADITYTSSGLQGLSLRVLPKHDNLS
SPYEAGVILWAH
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgcacttttaacgtttccccgtcgctaccgacaattctcgaaccccta
cgcaagcttgcctacaacttgcactgggactggaacgtcgataccaaagacctcttccgc
cgcctcgatcgagacctgtgggactccagcaaccaaaacccggtgctgatgctcggaacc
atatctcaagagcggctgcaagaaatggcagaagacgaaggcttcattgcccaaatgaac
cgagcagcccagcagttagacgattatctcaaaaatcgcgcctggtaccgcaaacagcgc
ggcaccgagcagcaagaatgctacgcatacttttcgatggaattcggcttagttaaagcc
ctaccgatctattcgggcggtttgggcgtgctcgcaggcgaccacctcaaatcagctagt
gatttgggcttgcccttagtgggtgtcgggctgctctaccaagaaggttatttttcgcag
tatctcaacgctgatggctggcagcaagaacgctatccgctcaatgatttctacaatatg
ccgctgcacccagaacgcaatcccgacggttcggaattgcggattgaggtggactatccc
ggccgcaaggtgtatgcccggatttggcgggtacaagtgggaacggttcctttgtacctg
atggatacaaatattgaacctaacagccgctacgaccaagatattaccgaccaactgtat
ggcggtgataaaactctgcggatgcaccaagaaatcatgctgggcatcggcggcgtgaaa
atgctcaaggcattggggctgacagttacggcttaccacatgaatgaaggtcacgcggct
ttcatggctttggaacgcattcggatgctgatggaggaatatcacctgagtttcgaggaa
gcggaacaggtggtcgtttcgagcagtatgtttacgactcacacgccggtacctgctggg
tttgacttgttcgagccggatatggtgatgcactatctaggtcagtatcccaagatgttt
ggcttgtcgcaagatgagtttttaggattgggccgggagaatactggcgatttgtccgca
cctctgaatatggcaattttggcaattaaaatgtcgagttttgtcaacggggtggccgct
ttgcacggtgtggtgtcgcgcccgatgtttcagggtttgtggccgggtttgcccgtggat
gaggtgccgattacttcgattaccaacggggtgcacgctcgcagttgtgtggcgaagtct
actcaggagttgtacgatcgatacctcggcccggagtgggaaatgactcgcaaggacgat
cgtctctgggacaggctgtcgtcgattcctgatgaggaactgtggcggaatcacgaacgc
tgtcgatcggagttggtggtgttcgcgcgggagtggctgcaaaagactttgcgcgagcgc
ggtgcggcccaaacggaaatcgaacacgcgcgggaggctctcaatccgaaggtgctgacg
atcgggtttgcccgccgctttgctacttacaagcgggcgacgctgtttttgcgcgatgtc
gatcgcattatgcggatcatgcgggacaaaaaccgcccggtgcagtttgtgattgctggg
aaggctcacccgatggatattccgggtaaggaattgattcgggatatcgttcacttcatc
cgcgagcacgagacgatgagttcgatggtgtttttgccgaactacgacattaacgtcgct
cggatgatggtgtccggctgcgatgtgtggctgaatacgccgcgccgcccccgcgaagct
tccggtacttcggggatgaaagcttcgatgaatggtttgccgaatctcagcatcctcgac
ggatggtgggatgaggctgattatgttcgtaccggttggccgatcggacatggggagttt
tacgaagatactaagtatcaggatgaggtcgaggcgaatgctttgtacgacttgatggaa
aaggaagttgtaccgctgttttacaaccgggatgctgatggcattccccgcggttggacg
gagaaaatgaaggattcgattcgcttgaactgtccttttttcaatactgctcggatggtg
aaagattacgcgcggcgggcttatttcccggtgagcgatcgctaccacaccatgacttcg
gataattgcgctcccgccaaggagttgtctcactggaagaagcacgttctcgcgaagtgg
cacgatattaagattgaggctgttgatatttcccaggataaggaagttaaggtcaatcaa
tcgatcgctgttaaatctcggattaatctcatgggattgacccctgcagacgtgcaagtc
gaactttatcaaggttcggttgatgctaacggagatattgtcggcggcgtgccggtggtg
atggagtatttgggagaagattctcacaatgctagcctttatacggctgacattacttat
acttctagcggtttgcaaggtttgtcgttgcgcgttttgccgaagcacgataatctcagc
agtccttatgaagctggcgtgattctctgggcacattag

DBGET integrated database retrieval system