KEGG   Oscillatoria nigro-viridis: Osc7112_1407Help
Entry
Osc7112_1407      CDS       T02375                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00473  D-Alanine metabolism
oni00550  Peptidoglycan biosynthesis
oni01100  Metabolic pathways
oni01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:oni00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Osc7112_1407
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Osc7112_1407
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Osc7112_1407
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:oni01011]
    Osc7112_1407
Enzymes [BR:oni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Osc7112_1407
Peptidoglycan biosynthesis and degradation proteins [BR:oni01011]
 Precursor biosynthesis
  Amino acid ligase
   Osc7112_1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AFZ05936
UniProt: K9VDC9
LinkDB All DBs
Position
1644160..1645230
Genome map
AA seq 356 aa AA seqDB search
MTTMRIGLLFGGRSGEHEVSISSARAIARALAAEENASKYEVLPFYIQKNGRWLSGTLPQ
QILASGKPLEIEEQTGQDDSPAGQFPNFNAVDVWFPVLHGPNGEDGTVQGLLKLMQVPFV
GSGVLGSAIGMDKIAMKMAFAQAGLPQVKYIAVNRSEIWSNPCVFPKLCDKIEADLGYPC
FVKPANLGSSVGISKARSRAELEAALDSAASYDRRIIVEAGVVARELECAVLGNDNPKAS
TVGEITFQSDFYDYETKYTLGQADCSIPAKVSSAIVSQIQEMAVQAFLAVDAAGLARVDF
FYIESTGEVLINEINTFPGFTATSMYPQMWAADGISFPELVDRLIQLALERHGEKG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatgcggatcgggctattgttcggggggcgatcgggcgaacacgaagtctca
attagttcggcgcgggcgatcgcccgcgccctcgctgcggaggaaaatgcttctaaatac
gaagttctgcccttttacatccaaaaaaacggccgctggctgtcgggaacattacctcaa
caaatcttagccagcggaaaacctctggaaatagaggaacaaacaggacaagacgattct
cccgctggacagtttcctaattttaatgccgtagatgtttggttccctgttttgcacggc
ccaaacggcgaagacggtacggtgcaagggttgctgaaattaatgcaagttccttttgtc
ggttccggggttttaggttcggccattggaatggataaaattgcgatgaaaatggctttt
gctcaggctggtttaccgcaggtaaaatacatcgctgtcaaccgttccgaaatctggtct
aatccttgcgttttccccaaactctgtgataaaattgaagctgatttgggctatccttgc
tttgtcaaaccggcgaatttgggttcgtctgtgggaatttctaaagctcgatcgcgcgct
gagttagaagcagccctcgacagcgccgccagctacgacaggcggataattgtcgaagcg
ggtgtagttgctagagaattagaatgtgcagttttgggaaacgacaaccccaaagcttca
acggtgggagaaattacttttcaaagcgatttctacgactacgaaactaaatatactctg
ggacaagccgactgctcaatcccggcaaaagtcagcagtgcgatcgtctcgcaaatccaa
gaaatggcagtgcaagcatttttggctgtagacgcagcaggtttagcgcgagtagacttt
ttctacattgaatcaaccggagaagttttgattaacgaaattaacacttttcccggcttt
acagctaccagtatgtatccgcaaatgtgggcagcggacggtatttctttcccggaatta
gtagaccgtttaattcaattagctctcgaacggcacggggaaaaaggttga

DBGET integrated database retrieval system