KEGG   Oscillatoria nigro-viridis: Osc7112_1678Help
Entry
Osc7112_1678      CDS       T02375                                 

Definition
(GenBank) hypothetical protein
Organism
oni  Oscillatoria nigro-viridis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFZ06173
UniProt: K9VDE5
LinkDB All DBs
Position
complement(1957232..1958893)
Genome map
AA seq 553 aa AA seqDB search
MTLHLLDKIGNWNPQLFREIKGRLNTGNMAIASAFSLSGQLLLLMYYSAQIPVTPRNGEY
TYPIYHRFCLETADSSTRKCVRDALGNFVINWREWWLEIFIWLSILSVLALLVAGTYLLV
SDLDKEERRGTLNFIRLSPQSAKTIFLGKILGVPILLYLAAILAVPLHLYAGLAAQIPLN
EILCFYTAVAASCALFYSGSMLFGLTTSWLGGFQPWLASATVFVVFGISCLPLTRAAGDV
LHFLSPLAILRYSLFLADKTDFDSLVENLDKLQWFYSPVGTNIASGIALSLLVCGTGTYW
MWQGWQRRFPNPSATVLSKRQSYLLVICCQVIFLGFALQSDPPNSANLICLLILNLVMFL
GLIAALTSDRQSLYDWARYRKQIVPSNQKLWRRYPLLDLIWSDKSPAVVAIAIDFLSSVI
ILTPWALLEKPDINGFWGVIGCLNLILIYAAITQLFLFTKTRNQEMWAICTVGGAILLPP
LILSMLLLTPEKAPILWLSSTFSGFWSSSLAASGNTFLLSILSQWTVLVLLNFKLRSQLK
LAGQSASKALLKA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgacactccacttactagacaaaataggcaactggaatccccagttatttcgagaaatc
aaaggccgcttgaatactggcaatatggcgatcgcctctgccttttccctaagcggtcaa
ctgctgctattgatgtattacagcgcccagatacccgttacccctcgtaatggggagtac
acttaccccatctatcacagattttgcttagagactgccgattcctctacgagaaagtgt
gtcagagatgccttgggcaactttgtcattaactggcgggagtggtggctagagatattc
atttggctgagcatattgagcgtgttagctttattagtagcagggacttatctacttgtc
agcgacttagacaaggaggaacgccgcggcacgctcaactttattcgcctcagtccccag
tctgccaaaactatttttctcggcaaaattcttggcgtcccaattttactgtatctagca
gcaattctggccgtaccgctgcatttgtatgctggattagctgctcaaatacccctgaat
gaaattttatgtttctacacagcggttgcagctagctgtgctttattttacagcggttcg
atgctatttggattgacaaccagttggttgggaggatttcaaccttggttggctagcgct
acggtttttgttgtgtttgggatttcttgcctcccgctcacgcgagctgctggggatgtg
ttacattttttgtctccccttgctatcctgagatattcgctttttctagctgataaaaca
gatttcgattcgttagttgaaaacttagacaagttgcaatggttttactcgccagtgggt
acaaatattgcgagcggcattgctttgtctctcttggtttgcggtacaggaacctactgg
atgtggcagggatggcagcgccgctttccaaatcccagtgctacagttttgagcaagcgg
caaagttatttgctagttatctgctgtcaggtaatatttttagggtttgcactccaatca
gaccccccaaactccgctaatctcatctgtttacttatcttgaatttggtgatgttctta
ggtttaattgcagctttaacatctgaccgacaatcattgtacgattgggcgaggtatcgg
aaacaaatcgttcccagcaatcagaagctgtggcggcgctacccgctactcgatttaatt
tggagcgataaaagtccggctgtagttgcgatcgcgatcgatttcctcagctcagtaata
attttaacaccttgggcgctgttggaaaaacctgatatcaacggattttggggtgtaatt
ggctgtctgaatctcatcctaatttacgcagccatcacccaactattcctatttaccaaa
acccgaaatcaggaaatgtgggccatctgcacagtcggtggcgctatcttgttgccgcct
ctgattttatctatgctcttactaaccccagaaaaagctcctattctctggttgtcttca
acatttagtggcttttggtcttcgtctttggcagcgtcaggaaatacatttttgctctcc
atactcagtcagtggactgtcttggtgttgttgaacttcaaattgcgatcgcaactgaaa
ctcgcagggcaatcagcttctaaagcactgctgaaagcttga

DBGET integrated database retrieval system