KEGG   Oscillatoria nigro-viridis: Osc7112_1877Help
Entry
Osc7112_1877      CDS       T02375                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00473  D-Alanine metabolism
oni01100  Metabolic pathways
oni01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Osc7112_1877
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Osc7112_1877
Enzymes [BR:oni01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Osc7112_1877
Peptidoglycan biosynthesis and degradation proteins [BR:oni01011]
 Precursor biosynthesis
  Racemase
   Osc7112_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF3575
Motif
Other DBs
NCBI-ProteinID: AFZ06361
UniProt: K9VEI3
LinkDB All DBs
Position
2164241..2165443
Genome map
AA seq 400 aa AA seqDB search
MLSWEQTAAESPTKESRQTLLWDGDGELCQRAWVEIDLAALTHNVKQLKKLLSPHTELMA
VVKADAYGHGAVAVSQTALQAGASWLGVATIPEGIELREAGIEAPILLLGATHTAQQVKA
IAQWHLQPTICTAKQALIFSEVLAGLNQSLPVHAKLDTGMSRLGTPWQEATEFVQLVKRL
PNLKLASIYSHLATADSPDPAVMREQHQRFQRAIEQIKIAGINPPRLHLANSAAALADPD
LHYDLVRVGLATYGLYPAPHLQPIANLKPAMQVKARVTQVKTIEAGTGVSYGYQFIAQRP
TQIAVIGIGYADGIPRNLSNKIQVLVRGQFVRQVGAVTMDQLMLDVTDIPDLEVGEVVTL
LGKDGENQITADDWAVILGTISWEILCGFKHRLPRVAVHY
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgttgagttgggaacaaacagccgcagaatcaccgacaaaagaatcccgccagacgttg
ctgtgggacggtgacggggaactttgccagcgggcttgggtagaaatcgatttagcagct
ttaactcacaatgtaaaacagcttaaaaagctcttatctccccacacagaactgatggca
gttgtgaaagcggatgcttacgggcacggtgctgttgcagtcagtcaaacagcattgcaa
gcaggtgctagttggctgggagtggcgacaattcccgaaggaatagaattgcgagaagct
ggcatagaagcgccgattttgttgttgggggcaacccatacagcccaacaggtaaaggcg
atcgctcaatggcacttgcagcccactatttgtactgccaaacaagccctaattttttcg
gaagttctcgctggtcttaaccaatctttgccagttcacgctaagttggatacgggaatg
tctcgcttgggtacgccctggcaggaagctacagaatttgtgcaattagtcaagcggttg
cccaatttaaaattagccagcatttactctcatttggcgacagccgacagtcccgatccc
gcagttatgagagagcagcaccagcggtttcaacgggcgatcgagcaaattaaaatagca
ggaattaacccccctcgcctccacttggcaaactctgctgccgccctcgctgacccggat
ttgcactacgatttagtgcgagtcggtttagctacctacggtctttatccagcgcctcac
ttgcagccgatcgccaatttaaagcccgcaatgcaggtaaaagctagggtaacgcaggtg
aaaacaattgaagcaggaaccggagtcagttacggctatcaatttatagctcagcgcccg
acacagattgccgtaattggtattggctatgcagatggtattccgcgcaatctttctaat
aaaatacaggttttagtcaggggtcagttcgtgcggcaagtaggagccgtgacgatggat
caattaatgctggatgtaactgatattcccgatttagaagtcggcgaagtggtgactctg
ttgggcaaagatggggaaaatcaaattactgctgacgattgggcagtcattttaggaact
atttcgtgggaaattctttgcggttttaaacaccgattgccccgcgtagcagtacactat
taa

DBGET integrated database retrieval system