KEGG   Oscillatoria nigro-viridis: Osc7112_2505Help
Entry
Osc7112_2505      CDS       T02375                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00010  Glycolysis / Gluconeogenesis
oni00520  Amino sugar and nucleotide sugar metabolism
oni01100  Metabolic pathways
oni01110  Biosynthesis of secondary metabolites
oni01120  Microbial metabolism in diverse environments
oni01130  Biosynthesis of antibiotics
oni01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Osc7112_2505
   00520 Amino sugar and nucleotide sugar metabolism
    Osc7112_2505
Enzymes [BR:oni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Osc7112_2505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Peptidase_S51
Motif
Other DBs
NCBI-ProteinID: AFZ06936
UniProt: K9VG50
LinkDB All DBs
Position
complement(2931893..2932600)
Genome map
AA seq 235 aa AA seqDB search
MTEQDRSTRTLAVDIGGSGIKVMVLDNEGEPQTERSRLETPQPPKPEPVLEAIASLASGQ
GEFDRVSVGFPGVVCGGVIKTAVNLDPSWIDFDLQTTLKDRLGKPVRVANDADIQGLGAI
AGTGVELVITLGTGFGSALFVDGILVPNLELGHHPFRKGETYEQQLGRLALDTVGSKRWN
RRLEKALTYLQDIFNCDRIYIGGGNTKKIAVELPPQVKIVPNVSGLLGGIALWRD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaagatcgatcgactcgcaccttagccgttgacattggcggaagcggcatc
aaagttatggtgttggacaatgaaggcgaaccccaaacggaacgcagccgtttagaaacg
cctcaaccaccgaaaccggaacccgtattagaggcgatcgcctctttagccagcggacaa
ggggaatttgaccgagtatccgtcggttttcccggcgtcgtctgtggcggcgtcatcaaa
accgcagtgaatttagatccgtcttggatagattttgacttacaaactactctcaaagat
cgcttgggaaaacctgtgcgagtagctaacgatgccgatattcaaggattgggagcaatt
gctgggacgggggtagaattagtaattacccttggcacgggtttcggttctgccttattt
gtcgatggtatcttggtgccaaatctagagttaggacatcacccgtttcgcaaaggggaa
acttacgaacagcaattaggtcgcttggcattagatacagtgggttccaaaagatggaat
cgccgcctggaaaaagcgctcacctatctgcaagatatctttaactgcgatcgcatttac
atcggcggcggtaatactaaaaagattgctgttgagttaccgccgcaggttaaaatagta
cccaatgtgagcggtttgttgggcgggattgctttgtggcgcgattga

DBGET integrated database retrieval system