KEGG   Oscillatoria nigro-viridis: Osc7112_2938Help
Entry
Osc7112_2938      CDS       T02375                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00970  Aminoacyl-tRNA biosynthesis
oni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oni00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Osc7112_2938
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:oni03029]
    Osc7112_2938
Enzymes [BR:oni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Osc7112_2938
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Osc7112_2938
Mitochondrial biogenesis [BR:oni03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Osc7112_2938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFZ07338
UniProt: K9VGW5
LinkDB All DBs
Position
complement(3428470..3429930)
Genome map
AA seq 486 aa AA seqDB search
MASIRELHRQLVNKERSAVEITQEALDRITQLEPKLKSFLCVTADSALAQAHQVDAQIAA
GEQIGLLAGIPIAVKDNMCTEGVPTTCASRILENFVPPYDATVVSKLQAAGAVIVGKANM
DEFAMGSSTETSAYQVTANPWDLERVPGGSSGGSAAAVASGECVVSLGSDTGGSIRQPAA
FCGLVGLKPTYGLVSRYGLVAYASSLDQIGPFGRTVEDSAILLGAIAGYDPRDSTSLNVP
IPDYAQALRPSLRPKGQIRIGVIKETFGVGLDSGVKDAVTKAIEQFQQLGAEIQVISCPR
FRYGLPTYYIIAPSEASANLARYDGVKYGFRSPDPDNLLDMYAKTRSQGFGAEVKRRIAI
GTYVLSAGYYDAYYLKAQKVRTLIKEDFEKAFSQVDVLVCPTAPTTAFKAGEKFNDPLSM
YLSDLMTIPVNLAGLPALSLPCGFDDKGLPVGIQLIGNVLQESRLFQVAHAYEQSTNWHL
HHPELH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcatccatccgcgagttgcaccgacaactggtcaataaagaacgctctgctgtggaa
attactcaagaagcattagaccgaattacccagctagagccgaagttgaaaagctttctg
tgcgtgacggcagacagcgcattggcgcaggcccatcaagtggatgcccaaatcgcagcc
ggagagcaaattggcctgttggccggcatcccgatcgccgttaaagataatatgtgcacc
gagggcgttcccacaacctgcgcctctcggattttagagaattttgttcctccctacgat
gccaccgtcgtctccaaactccaagcagccggtgcggtgattgtgggtaaggcgaatatg
gacgagtttgcaatggggagctcgacggaaacttctgcctatcaagttaccgcgaatcct
tgggacttggagcgcgtgcccggagggtcttctggcggttctgccgcagcagtggcctcg
ggagaatgcgtcgtgagtttgggttcggatactgggggctcaatccgccaacctgctgct
ttttgcgggttggtggggctgaaaccgacttatgggttggtttctcgctacggtttggtg
gcctatgcttcttctctcgatcaaatcgggccctttggccggacggttgaggattcggcg
attttgttgggggcgatcgccggttacgatccgagagattccacgagtcttaatgtccca
attcctgactacgctcaagctttaagacccagtttgcgaccgaagggtcagattagaatt
ggtgtaattaaagaaacttttggtgtagggctggactcgggggttaaagacgctgttact
aaggcgatcgagcaatttcaacaattgggcgcagaaattcaagtcatttcttgtccccgg
ttccgctacggtttgcccacttactacataattgctccctcggaagcttcggcaaatttg
gcgcgatatgatggagtcaagtacggtttccggtctccagaccccgataatcttttggat
atgtatgccaaaacccgctctcaggggttcggtgcggaagttaaacgccggattgcgatc
ggcacttacgtattgtcggcgggatattacgatgcctattatctaaaagctcaaaaagtt
cggactttgattaaagaagactttgaaaaagctttttctcaagttgatgttttagtctgt
cccactgctcctactaccgcatttaaggcaggcgaaaaattcaacgatcccctgagtatg
tatttgtcagatttgatgactattccggtgaatcttgctggtttgccagctttgagtttg
ccctgcggatttgacgataaaggactgcccgtgggtatacaactgattggtaatgttttg
caagaatctcggttgtttcaggtggctcacgcttacgaacagtctacgaattggcactta
caccaccccgaattgcattaa

DBGET integrated database retrieval system