KEGG   Oscillatoria nigro-viridis: Osc7112_4737Help
Entry
Osc7112_4737      CDS       T02375                                 

Definition
(GenBank) adenylate/guanylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00230  Purine metabolism
oni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oni00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Osc7112_4737
Enzymes [BR:oni01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Osc7112_4737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA Guanylate_cyc Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: AFZ09023
UniProt: K9VLR4
LinkDB All DBs
Position
5672842..5673828
Genome map
AA seq 328 aa AA seqDB search
MTLQANPHLVLRTEKGGNRYLPLSGSNCWTVGRSDDNNFVLTDRWISRNHAMLQQMETGE
FYLIDLGSRNGSFVNGRRVSIPVTLRNGDRIIFGQTELDFYNPTAGHRHDPIHETDSEDF
TATLTVRSLISVMVMDIRDFTVLTRQLDETLLSEVIGNWFRKAGQIIREHGSWVDKYIGD
AIMAVWFHKTSGVSSEEMMRICQALSELHKATDELSSRYPLPFPLRVGAGINTGYAMVGN
SGSSDRSDYTALGDTVNAAFRLESCTKQIGKDIAVGKTTYEYLTELGAQGAFEQHTVALK
GYDTPSVIYGGTYGDLNAFLKRKGKSSQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgcaagccaatccacatttggtacttcgtacagagaaaggcggcaatcgctac
ttgccgctctccggcagcaattgctggacagtagggcggagcgatgacaataattttgta
ctgacagatcgctggatttcccgcaatcacgcgatgttacagcaaatggagacaggagag
ttctacctgatcgacttgggcagccgcaatggttcttttgtcaacgggcggcgggtcagt
attcctgtaactctcagaaatggcgatcggattattttcggtcaaaccgaattggacttc
tacaacccaaccgccggccaccgccacgatccaatacacgagacagactctgaagatttt
acggcgactttgacggtgcgtagcctgattagcgtcatggtaatggacatccgagacttt
acagttttgactaggcagctagacgaaaccctcctctcggaagtcatcggtaattggttc
cgcaaagcaggacagatcattcgcgaacacggcagttgggtggacaaatacatcggcgat
gccatcatggcagtctggttccacaaaaccagcggtgtcagcagcgaggaaatgatgcgg
atttgccaagctttgagcgaactgcacaaggcaacagacgaactcagcagccgttacccc
ctgccttttcctttgcgagtcggggctggcatcaataccggttatgcaatggtgggaaat
tctggcagcagcgaccgatcggactataccgccttgggtgatactgtaaacgcagcattt
cgcctggaatcttgcaccaagcaaatcggcaaggatatcgctgtgggaaaaaccacctac
gaatacctgacggaattgggggcccagggcgctttcgagcagcacaccgttgctttgaag
ggttacgacactcccagcgtgatttacggcggtacttacggtgacttgaacgcttttctc
aaaaggaaaggaaagagttctcaatag

DBGET integrated database retrieval system