KEGG   Oscillatoria nigro-viridis: Osc7112_5385Help
Entry
Osc7112_5385      CDS       T02375                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
oni  Oscillatoria nigro-viridis
Brite
Enzymes [BR:oni01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Osc7112_5385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Phage_portal
Motif
Other DBs
NCBI-ProteinID: AFZ09621
UniProt: K9VNW9
LinkDB All DBs
Position
6429295..6429897
Genome map
AA seq 200 aa AA seqDB search
MAFELAPLPFAADALEPAHMSANTFSFHHDKHHAAYVTNLNKLIEGTEMASKSLEEIVKE
SAKDPSKAGIFNNAGQVWNHNFFWNSLKPGGGGTPTGALADKINADFGSFDKFKEEFKTA
ATTQFGSGWAWLVLDNGTLKVTKTANADTPVAHGQTPLLTLDVWEHAYYLDFQNRRPDYI
TNFLDNLANWDFAAANLAAA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaacttgcaccgttacccttcgccgctgacgccctagaaccagctcatatg
tcggcgaacacgttttcgttccaccacgacaagcaccacgctgcttacgtgaccaatctg
aataaactgattgaaggaacggaaatggcgagcaaatcccttgaagaaattgtcaaggaa
tctgctaaagacccatccaaagccggcattttcaacaatgcaggtcaagtttggaaccac
aattttttctggaattccctcaaaccgggcggcggcggtactccgacaggagctttagct
gacaaaattaacgccgacttcggcagctttgacaaattcaaagaagaatttaagactgca
gcgacaactcagttcggtagcggctgggcttggctggttttggataacggcactttgaaa
gtcaccaaaactgctaacgccgacactccggtagcacacggccaaactccgttgctgact
ttggatgtgtgggaacacgcttattatttggatttccaaaaccgccgtcccgactacatt
actaatttcttggataatttggctaactgggatttcgcagcagcaaatttggctgcggct
tag

DBGET integrated database retrieval system