KEGG   Oscillatoria nigro-viridis: Osc7112_5803Help
Entry
Osc7112_5803      CDS       T02375                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00630  Glyoxylate and dicarboxylate metabolism
oni00710  Carbon fixation in photosynthetic organisms
oni01100  Metabolic pathways
oni01120  Microbial metabolism in diverse environments
oni01200  Carbon metabolism
Module
oni_M00165  Reductive pentose phosphate cycle (Calvin cycle)
oni_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
oni_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:oni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Osc7112_5803
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Osc7112_5803
Enzymes [BR:oni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Osc7112_5803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AFZ10011
UniProt: K9VPY5
LinkDB All DBs
Position
6951541..6952971
Genome map
AA seq 476 aa AA seqDB search
MAYAQTQTQSKAGYKAGVQDYKLTYYTPDYTPKDTDVLAAFRVTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYICFIAYPLDLFEEGSVTNLLTS
LVGNVFGFKALRALRLEDLRIPIAYLKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYEVLRGGLDFTKDDENINSQPFMRWRDRFLFVQEAIEKAQAETGEVKGHY
LNVTAPTCEEMMERAEFAKEIKTPIIMHDYLTGGFTANTSLAKWCRRNGVLLHIHRAMHA
VIDRQKNHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGEKGITMGFVDLMREDHIEQDRA
RGIYFTQDWASMPGVMPVASGGIHIWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATA
NRVALEACVQARNEGRNLMREGGDIIREACRWSPELAVACELWKEIKFEFEAMDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgcgcaaacccaaactcaatcaaaggctgggtataaagccggagttcaagac
tataaactaacgtattacacgccggactacaccccaaaggatacagatgttttggcggct
ttccgggtaacaccgcagccgggagttcccccagaagaagcaggcgctgctgtggctgct
gaatcttctacaggtacatggacgactgtttggactgacctcctgaccgacctcgaccgc
tacaaaggtcgctgctacgacatcgagccagttcccggtgaagacaaccaatacatctgc
ttcattgcttatcctttggatttgtttgaagaaggttcagtcaccaacttgctgacctcg
ttggtcggtaacgtgttcggtttcaaagctctgcgcgctctgcggttggaagacttgcgg
attcccattgcttacctgaaaaccttccaaggccctcctcacggtattaccgtcgagcgg
gacaaattgaacaagtacggtcgtcctttgctgggctgtacaattaagcccaaattgggt
ctgtctgctaagaactacggtcgtgccgtttacgaagttctgcgcggcggtttggacttc
accaaagacgacgaaaacatcaactcgcagccgttcatgcgctggcgcgatcgtttcttg
ttcgttcaagaagctattgaaaaagctcaagcagaaaccggcgaagtcaagggccactac
ctcaacgtaaccgcccccacctgcgaagaaatgatggagcgggctgagttcgctaaggaa
atcaaaacccccatcatcatgcacgactacctgaccggtggtttcactgcaaacaccagc
ttggccaaatggtgccgccgcaacggtgtgttgctgcacatccaccgcgccatgcacgcc
gtgatcgaccgtcagaagaaccacggtatccacttccgcgtacttgccaagtgcttgcgg
atgtccggcggcgaccacctgcactccggtacagttgtgggcaaactcgaaggcgaaaaa
ggcatcacgatgggcttcgtagacttgatgcgcgaagaccacatcgaacaagaccgcgct
cgcggtatctacttcacccaagattgggcttccatgcccggtgtcatgccggttgcttcc
ggcggtatccacatctggcacatgcctgctttggtggaaattttcggcgacgactcctgc
ttgcagtttggtggcggtaccttgggacacccttggggtaacgcacctggtgcaactgct
aaccgcgttgctttggaagcttgcgtccaagctcgtaacgaaggtcgcaacctgatgcgc
gaaggcggagacattatccgcgaagcttgccgttggagccctgaattggccgttgcttgc
gaactgtggaaagaaatcaagttcgagtttgaagcaatggataccgtctga

DBGET integrated database retrieval system