KEGG   Oscillatoria nigro-viridis: Osc7112_6078
Entry
Osc7112_6078      CDS       T02375                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00010  Glycolysis / Gluconeogenesis
oni00020  Citrate cycle (TCA cycle)
oni00620  Pyruvate metabolism
oni01100  Metabolic pathways
oni01110  Biosynthesis of secondary metabolites
oni01120  Microbial metabolism in diverse environments
oni01200  Carbon metabolism
Module
oni_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Osc7112_6078
   00020 Citrate cycle (TCA cycle)
    Osc7112_6078
   00620 Pyruvate metabolism
    Osc7112_6078
Enzymes [BR:oni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Osc7112_6078
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase DEC-1_N ATP-grasp Aminotran_1_2 GCV_H
Other DBs
NCBI-ProteinID: AFZ10268
UniProt: K9VQA0
LinkDB
Position
7266108..7267403
AA seq 431 aa
MIREVFMPALSSTMTEGKIVSWVKSAGDKVEKGETVVVVESDKADMDVESFYEGYLAIII
VPAGEVAPVGAAIALVAETEAEIAVAQQQGAAAPTAAAAPAPSPAPVSAATSSAGLQQNV
SRQNGRSVVSPRARKLAKEFKVDLNSIKGSGPNGRIVAEDVEAAAGKAQPVPVQQQVTVP
AAPAPVPAAPAPAAAKPAPAPVPAIALSGQTVPMNALQNAVVRNMEASLSVPSFRVGYTI
TTDNLDKLYKQIKSKGVTMTGMLAKAVAVTLQKHPLLNACYVESGIQYRADINVAVAVAM
DGGGLITPVLQNADRLDIYSLSRTWKDLVDRARTKQLKPDEYSTGTFTLSNLGMFGVDKF
DAILPPNQGSILAIGSSRPQVVANEEGLMGVKRQMQVNITCDHRIIYGADAAAFLQDLAK
LLETNPQSLTL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgattcgcgaagttttcatgccagccctgagttcgacaatgacagagggcaaaattgtt
tcctgggtcaaatccgccggagacaaagtagaaaaaggcgaaacggtggtagtcgttgaa
tccgacaaagccgacatggacgtggagtctttctacgaaggctatttagcaataattatc
gtacctgccggcgaagttgctccggtgggggcggcaatcgccctcgtagcagaaacagaa
gccgaaatcgccgtcgctcagcagcaaggagccgccgccccaaccgcagccgccgccccc
gctcccagccccgctcctgtcagcgcagctacatcgtcagcaggtttgcagcaaaatgtc
agccgccaaaacggccgcagcgtcgtttctccccgcgctcgcaagttagccaaagagttt
aaagtagatttgaattctatcaaaggcagcgggcccaacggtcgcattgtcgcagaggat
gtggaagcagcagccggcaaagcccaacccgttccggttcagcaacaggtaacagtcccc
gcagcacccgcaccagtccctgcggcacccgcccccgccgcagcaaaacccgcacccgca
ccagtcccggcgatcgcactttcgggccaaacagtaccgatgaacgcgctgcaaaatgcg
gtggtgcggaatatggaagcaagtttgagcgtgccgtctttccgcgtcggttacacaatt
actactgataatctggacaaactctacaaacaaattaagtccaagggcgtcacgatgacg
ggtatgctggcgaaggctgtagcagtaactttacaaaaacatcctctgctgaatgcttgt
tatgtggagtcgggaattcaataccgcgctgatattaatgtggcggtagcggtggcgatg
gacggcggcggtttgattacgccggtgctgcaaaatgccgatcgcctcgatatttattcg
ctctcgcgcacttggaaggatttagtcgatcgcgcccgcaccaagcagttgaagcctgat
gaatacagcacgggaacttttactctttccaatctgggaatgtttggagtagacaagttt
gacgcgattttgccgccgaatcaaggctcgattttggcgatcggctcttcgcggccgcaa
gtagtggcaaacgaggaaggtttgatgggagtgaagcgccaaatgcaggtgaatattact
tgcgatcaccggattatttacggtgctgacgctgcggcattcttgcaagatttagcaaaa
ttgcttgagacaaatcctcagtctttgacgctttag

DBGET integrated database retrieval system