KEGG   Oreochromis niloticus (Nile tilapia): 100534398
Entry
100534398         CDS       T06104                                 

Definition
(RefSeq) glucocorticoid receptor isoform X2
  KO
K05771  glucocorticoid receptor
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100534398
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:onl03000]
    100534398
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:onl03310]
    100534398
Transcription factors [BR:onl03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100534398
Nuclear receptors [BR:onl03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100534398
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100534398
NCBI-ProteinID: XP_003445950
Ensembl: ENSONIG00000017907
UniProt: A0A669B0L8
LinkDB
AA seq 779 aa
MDKGGVKKIAYRRDDHLSKLVYTESPEEGGLLRVAPHSAMSVTSPASVVLPSSSLMQPGQ
VPNGLNNSPLPEELTSASVIATVGSLIDGPEPRGLTKDQRPQHQQQLLQTQTTFGHQTLS
ENLSQLDASMADITQSSMDSLIGGSDPNFFHLKTEDFSLDKGEQDPIDLDNAFEPIGKDM
DVNQKLFSDNTLDLLQDFDLTGSPSDFYVGDDAFLSTLADDSLLGVTSERDIKPAVVDSS
NTTGAVPVALNGSSVTNPAQSSPTISTTTSLSPETTLSAMVKKEKDANFIQLCTPGVVKQ
EKTGGQSYCQISGTASGDMAGTNAVSVCGVSTSGGQTYHFGVNPLSSDSQLQNEQKPVSS
LFLPVTTIGGVWNRGQGVGNNSLVQRAGEGFSGSPSYPTSFTRQEGSTATSSTQGKSGTH
KICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRF
RKCLMAGMNLEARKLKKNRLKGVQQSNPPEVAPSPPVETRSLVPKCMPQLVPTMLSLLKA
IEPDTIYAGYDSTLPDNSTRLMTTLNRLGGRQVISAVKWAKALPGFRNLHLDDQMTLLQY
SWLFLMTFSLGWRSYQQCNGNMLCFAPDLVINEERMKLPYMTDQFEQMLKICSEFVRLQV
SHDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMSYIKELGKAIVKREENSSQNWQRFYQL
TKLLDSMHEMVGGLLSFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGSIKPLLFHQR
NT seq 2340 nt   +upstreamnt  +downstreamnt
atggataaaggtggagtgaagaagatagcatacagaagagatgaccatttaagcaaactg
gtctacactgaaagccccgaggagggaggtctgttgagagtagctcctcacagtgccatg
tctgtcacctctcccgcctctgtcgttcttccatccagctctttgatgcagccaggacag
gtgcccaacggcctcaacaacagcccccttcctgaggagctcacctctgcctctgtcatt
gccaccgtaggctccttgatagacggtccagagccccggggattgaccaaagatcagaga
ccccagcaccagcagcagttacttcagacgcagacgacttttggtcatcaaaccttgtca
gaaaatttgtcccagttggatgccagtatggcagacatcacccagtcctccatggattcg
ctaattgggggatcagatcccaacttcttccatttgaaaacggaggatttctccttggat
aaaggagagcaggacccaattgaccttgataatgcctttgagcccattgggaaagatatg
gatgtgaaccaaaagttgttcagtgacaacactctggatctgctccaggactttgacctc
actgggtccccttcagatttttatgtaggggatgatgcttttctgtctactcttgcagat
gattctttgcttggagtgacatccgagagggacataaaacctgctgtagttgacagcagt
aacacgactggggcagtgcctgttgcccttaatggcagcagtgtgaccaatccagctcaa
tccagccctaccatatccacaactacttcactatcccctgaaaccactctgtctgcaatg
gtgaaaaaagaaaaagatgcaaacttcatccagctctgcaccccaggtgtggttaaacag
gagaagaccggaggacagagttattgccaaattagtggcacggcttccggagacatggcc
gggactaatgcagtctcagtctgtggggtcagcacttcaggaggacagacctaccacttt
ggtgtgaacccactgagcagtgatagtcagctgcagaatgagcagaagccagtgtccagc
ctgttcctcccagtaacgaccatcggtggggtgtggaaccgaggccagggtgttggtaac
aactcattagtccagagggctggtgaggggttctcaggttccccctcctaccccaccagc
tttaccaggcaggaagggagcactgctacatcctccacacaaggaaagagcgggactcat
aaaatctgcctggtgtgctctgacgaggcttctggctgccactatggcgttctcacctgc
ggcagctgcaaagtcttcttcaagagagcagtagaagggcaacataattacctgtgtgca
gggaggaatgactgcataatagacaaaatcaggaggaagaactgcccagcctgccgattc
cgaaagtgtctgatggcaggcatgaatctggaagctcgcaaattaaagaagaatcggtta
aagggtgtccagcagagcaacccaccagaggttgcaccttctccgccagttgagacccgc
tccctcgtacccaagtgcatgcctcagctcgttccaacaatgctatccctgctgaaggcg
atagagccagacaccatctacgctggctatgacagcaccctgcccgacaactccacccgc
ctcatgaccactctcaacaggcttggaggccgacaggtcatctctgccgtcaagtgggcc
aaggctctgccaggtttcaggaacctgcacctggatgaccagatgactctgctgcagtac
tcctggctcttcctcatgacttttagtttgggctggaggtcttaccagcagtgcaacggc
aacatgctgtgctttgcgccagacctcgtcatcaatgaggagaggatgaagctgccctac
atgaccgaccagtttgagcagatgctgaagatttgcagcgagtttgtccggctgcaggtt
tcccacgatgagtacctgtgcatgaaggtcctgctgctgctcagcacagtgccaaaggac
ggcctgaagagtcaagcagtgtttgatgagattcgcatgtcgtatatcaaggagctagga
aaagccattgtgaagcgtgaggagaactccagccagaactggcagcgattctatcagctc
accaagttgctggattccatgcatgagatggtcggcggtctgctgagtttctgcttctac
acctttgtgaataaatccctgagcgtggagttcccagagatgctggcagagatcatcagc
aaccagttaccaaaattcaaggctgggagcatcaaacctctgctcttccaccagagatga

DBGET integrated database retrieval system