KEGG   Oreochromis niloticus (Nile tilapia): 100534432Help
Entry
100534432         CDS       T06104                                 

Definition
(RefSeq) carbonyl reductase-like 20beta-hydroxysteroid dehydrogenase
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00590  Arachidonic acid metabolism
onl00790  Folate biosynthesis
onl00980  Metabolism of xenobiotics by cytochrome P450
onl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100534432
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100534432
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100534432
Enzymes [BR:onl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     100534432
    1.1.1.189  prostaglandin-E2 9-reductase
     100534432
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     100534432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR HATPase_c
Motif
Other DBs
NCBI-GeneID: 100534432
NCBI-ProteinID: NP_001266577
Ensembl: ENSONIG00000001577
UniProt: Q8UVJ2
LinkDB All DBs
Position
LG13
AA seq 280 aa AA seqDB search
MVSFYMSTRVAVVTGSNKGIGLAIVRALCKQFEGDVYLTARNVGRGEAAVKALNSEGLKP
MFHQLDIDDLNSIKTAAEFFKQKYAGVDVLINNAAIAFKVADTTPFGTQAEVTLKTNFFS
TRNMWTVFNEIIKPGGRVVNVSSMVSISALNKCNLDLQQRFRNENITEEELVELMQRFVD
EAKKGEHKERGWPDTAYGVSKIGVTVLSMIHARRLTKERPNDGILLNACCPGWVRTDMAG
PKAPKSPDEGAVTPVYLALLPPGAKEPHGQFVSEKTVQKW
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggtctctttttacatgtcaacccgagttgctgtggtaactggaagtaacaagggcatc
ggtctggccattgtccgagcgctctgcaaacagtttgaaggagatgtttatctcactgcc
agaaatgtaggccgtggtgaggcagcggtgaaggctctgaactcagagggactgaagccc
atgtttcaccagctggacatcgacgatctgaacagcatcaaaaccgccgccgagtttttc
aaacagaaatacgcaggagtggacgtcctcatcaataacgctgcgatagcattcaaagtg
gcagacacgactccgtttggcacccaggcggaggtgaccctcaagacaaacttcttctcc
accagaaacatgtggactgtcttcaatgagatcatcaaacctggaggtcgtgtggtgaac
gtctccagcatggttagcatcagtgctttgaacaagtgcaacctggacctccagcagcgc
ttccgcaacgagaacatcacagaggaggagctggtggaactgatgcaacgatttgtcgat
gaggccaagaaaggcgaacataaagagcgcggctggcctgacacggcctatggagtgtct
aaaattggagtgacggtgctgtccatgattcatgctcgtcgtctgaccaaggagagaccg
aatgacgggatcctgttgaacgcctgctgcccaggatgggtgcgcaccgacatggctgga
ccaaaagctcccaagtcgccagacgagggcgctgtcacgccggtctacctggctttgctg
ccacctggagccaaagagcctcacggacagtttgtctctgaaaagaccgttcagaagtgg
tga

DBGET integrated database retrieval system