KEGG   Oreochromis niloticus (Nile tilapia): 100534588
Entry
100534588         CDS       T06104                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100534588 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:onl03000]
    100534588 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:onl03310]
    100534588 (nr3c1)
Transcription factors [BR:onl03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100534588 (nr3c1)
Nuclear receptors [BR:onl03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   100534588 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 100534588
NCBI-ProteinID: XP_003446987
Ensembl: ENSONIG00000008483
LinkDB
AA seq 803 aa
MDQGGLKRNGNRDDGLTFAEIGGTGDTPGSLFQSAMHLPGSLPPATVAPNRQGGTNGQGE
LGGLFESHQHHVLGEGTDMKESKMIRMQKQQQQQQQDIGIFGMGDSLPLFNQCISDTPTS
VINTSDTSVLGNLPLPDLFSHPIKTESILSLDKDLGTYSGHTGTGLCDLDGNSGRLIEDT
EIWQDLDLPSSLPEISAFELDSEVAHLDNILQESAGGGCPVSGLPKEIKPLMGNGENCTS
VNGTEQQHHALHPHQQQQQQQHHQLIHHQQHQPQHHQPQALLSTVIIKEEKDPDESFIQI
CTPGVIKQEKQDSAFCQPQCLQSSISSLQGGGPGPMSSPVGVGAVPGYHYRANPSSTMGI
QDQKPFDMYSNMPLMGDGWARGKRYGETSGIQSSDDGLTPVASLAPFSVGFSSSSPREGE
ISSSVVPAQSKTSGQTHKICLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQNTDGQ
HNYLCAGRNDCIIDKIRRKNCPACRFRKCLQAGMNLEARKNKKLIKMKVHRAGASEPTIS
NMPVPVVPRSMPQLVPTMLSILKAIEPEIIYSGYDSTLPDTSSRLMSTLNRLGGQQVVSA
VKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFSLGWRSYEQCNGSMLCFAPDLVINKDRM
KLPFMTDQCEQMLKICNEFVRLQVSYEEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMTYI
KELGKAIVKREENPSQNWQRFYQLTKLLDSMQEMVEGLLQICFYTFVNKTLSVEFPEMLA
ELISNQIPKFKDGSVKALLFHQK
NT seq 2412 nt   +upstreamnt  +downstreamnt
atggatcagggtggactgaagcgcaatggtaatcgagacgacggcctgacatttgcggag
ataggaggtactggtgacacacctggttcactgttccagtctgcaatgcatctgcctggg
tctctgccccctgccacagtggcccccaatagacagggtggaaccaatggccagggggag
cttggaggcctgtttgagtctcatcagcatcatgttctgggtgaggggacagacatgaag
gagagtaaaatgattcgaatgcagaaacaacaacagcagcagcaacaggatattggtata
ttcggcatgggggacagcttgccattgtttaaccagtgtatttccgatacacccacatct
gtcatcaacacctcagacacttccgtcctaggcaaccttcctctgcctgaccttttttcc
caccccataaagacggaaagcattctttctctggacaaagacttgggaacatatagtggg
cacacaggcactggtctatgcgatttggatggcaacagtggccgcctgattgaggataca
gagatttggcaagatctggaccttcccagctcactgccagaaatcagtgcttttgagttg
gattcagaagtggcacacttggataacattctacaagagagcgccggtggtggctgtcct
gtcagtggcttgccaaaggaaataaagcctctcatgggtaacggagaaaactgtaccagt
gttaatggcacagagcagcaacaccatgccctacacccccatcaacaacagcagcagcag
cagcaccaccaactaatacatcaccagcaacatcagccccagcatcaccagcctcaggcc
cttctctccactgtcatcatcaaggaagaaaaggatcctgacgagtctttcattcaaatc
tgtacccctggtgtgataaaacaggagaagcaggatagtgctttctgccagcctcagtgt
ctccagagcagcatcagttctctccagggaggaggaccaggccccatgtcctcccctgtg
ggtgtcggagcagtgcccggctaccactacagagccaacccgagctcaacaatgggcata
caagaccagaagccttttgacatgtactcaaacatgcctctgatgggggatggctgggcc
cgggggaaaaggtatggagagacatctgggattcagagcagcgatgatgggctcactcct
gtcgcgtccttggcacctttttctgttggcttctccagttcatcacccagagaaggagag
atcagcagctctgtggtacctgcccaatccaagaccagtgggcagactcataagatctgt
ttggtgtgctcagatgaggcctctggatgccattacggggttgtaacatgtggcagctgc
aaagttttcttcaagagagccgttgaaggatggagagcacgacaaaacacagatggccag
cacaactacctgtgtgcagggagaaatgactgcatcattgataagatccgcaggaagaac
tgtccagcctgccgcttcagaaaatgtcttcaagctggaatgaacttggaagcaaggaaa
aacaaaaagctgatcaagatgaaagtgcaccgggctggggcatcagagcccaccattagc
aacatgcctgttccagtcgtacccaggagcatgccccaactcgtgccgaccatgctgtcc
atactgaaggccatagaaccagagatcatctactcgggctatgacagcacactgccagat
acttcatcacggctcatgtctactctcaacaggctagggggacagcaggttgtctctgca
gtcaagtgggccaagtcactaccaggcttccgcaatctgcaccttgatgaccagatgact
ctgctgcagtgctcctggctctttctcatgtctttcagtcttggctggaggtcatacgag
cagtgtaatggcagcatgctttgtttcgcccctgatcttgtcatcaacaaagatcgcatg
aagctgcccttcatgactgaccagtgcgagcagatgctgaagatctgtaatgagtttgtc
agactgcaggtgtcctatgaagagtacctgtgcatgaaggtgctgttactgctcagtaca
gtaccaaaagatggcctgaagagccaagcagtttttgatgagatcaggatgacctatatc
aaggagctgggaaaagccatcgtcaagagagaggagaaccctagtcagaactggcaacgc
ttctaccagctaactaagctactcgactccatgcaggagatggtcgagggtcttctccag
atctgtttctacacctttgtgaataaaaccctcagtgtggaattcccggagatgctggca
gagctcatttccaaccagataccaaaattcaaagatggaagcgtcaaagctctgctgttt
catcagaaatga

DBGET integrated database retrieval system