KEGG   Oreochromis niloticus (Nile tilapia): 100691051
Entry
100691051         CDS       T06104                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04068  FoxO signaling pathway
onl04110  Cell cycle
onl04115  p53 signaling pathway
onl04218  Cellular senescence
onl04310  Wnt signaling pathway
onl04340  Hedgehog signaling pathway
onl04371  Apelin signaling pathway
onl04510  Focal adhesion
onl04530  Tight junction
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100691051 (ccnd1)
   04340 Hedgehog signaling pathway
    100691051 (ccnd1)
   04371 Apelin signaling pathway
    100691051 (ccnd1)
   04068 FoxO signaling pathway
    100691051 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100691051 (ccnd1)
   04115 p53 signaling pathway
    100691051 (ccnd1)
   04218 Cellular senescence
    100691051 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100691051 (ccnd1)
   04530 Tight junction
    100691051 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100691051
NCBI-ProteinID: XP_003459332
Ensembl: ENSONIG00000005425
UniProt: A0A669DBR8
LinkDB
AA seq 292 aa
MEDQLLCCEVDSIRRAYQDVNLLNDRVLHTMLKAEENYLPSPNYFKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEATRKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVLPEELLQMELLVLNKLKWDLASVTPHDFIEHFLSKLKIYPSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVAAAVQGLYLKSQDVSLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNGTTETKQVDEDADLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgctgtgaggtggactccatcaggagagcttaccaggacgtc
aacctgctcaatgaccgagttctacacaccatgctgaaggccgaagaaaactacttgcct
tcgccaaactacttcaagtgtgttcagaaagaaattgtaccaaaaatgcgaaaaatagtt
gccacctggatgttggaggtctgcgaggaacagaaatgtgaggaggaggtttttccgctc
gctatgaactacttggacagatttctatcagttgaggccaccaggaaaacaagactacag
ctgctcggagccacatgcatgtttctagcatccaaaatgaaggagaccgtgcccttaacg
gcggagaaactctgtatttacacggacaactcggtcctgcccgaggaactgctgcaaatg
gagctgctggttctcaacaagctcaagtgggatctggcttcagtaactcctcatgacttc
atcgagcacttcctgtccaagctgaagatctatccctccaccaagcagatcctcaggaaa
catgcccagacctttgtggcactgtgtgctacagatgtcaacttcattgccagccctccc
tcaatggtggcagcagggagtgtagcagcagctgttcaagggctctacctgaagagccaa
gatgtgtccttgtcttcccagaacctcactaacttcctgtcgcaggtcattcgtagcgac
ccggactgcttgcggtcatgtcaggagcagatagagtctctgctggagtctagcctgcga
caggcacaacagcacaatggcacaacagaaactaaacaagttgacgaggacgcagacttg
tcctgcaccccaacagacgtcagagacatcaacatctga

DBGET integrated database retrieval system