KEGG   Oreochromis niloticus (Nile tilapia): 100692594
Entry
100692594         CDS       T06104                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04020  Calcium signaling pathway
onl04144  Endocytosis
onl04510  Focal adhesion
onl04540  Gap junction
onl04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100692594 (pdgfra)
   04020 Calcium signaling pathway
    100692594 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100692594 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100692594 (pdgfra)
   04540 Gap junction
    100692594 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100692594 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:onl01001]
    100692594 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:onl04090]
    100692594 (pdgfra)
Enzymes [BR:onl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100692594 (pdgfra)
Protein kinases [BR:onl01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100692594 (pdgfra)
CD molecules [BR:onl04090]
 Proteins
  100692594 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set Herpes_gE C1-set C2-set_2 Receptor_2B4
Other DBs
NCBI-GeneID: 100692594
NCBI-ProteinID: XP_005478935
UniProt: A0A669DY06
LinkDB
AA seq 1467 aa
MDWLKTFVLFGGSLVVLVSVTSGLLPPTILSDQEEFVLQPNSLFNISCTAKTHVVWEEPL
QKNALVYPGYYTSTLFIYNATVENTGYYTCKYEDPDEELEADEAEIYIFVPDPHAPFVPE
LPTDLVVSVDNYGFNIPCRVSHWDSYVILRKVPSGEALHALYNSKEGFFSNNLTPGQYQC
ETTLNGQIVRSSIYTVISNDPMEGKDFDDSDMEVIASEETLRAGQPFNITCIVPSGLDFQ
QQWLHPKKQAKDAVLMKETFPERVAYILSIPRAASQDSGTYECSVTDKSGEVRVKKVAVT
VFEENSFVAMDHSGILSTEFVHSFEETEFTIIIDAYPAPKVTWMKDGKDLQVNYYLFTTT
SHQGGNRYLSTLKFRHPLEKDNGNYTIIAQSGSHTAQFSFNLHMKAPTAGMIPSSSVPLL
LPKLDEMVVTLHTPFTLTCHGQENLGWETPIDVSEQTQEDPNGLFISTITVDSATASHTG
YYTCFYSRTFAEDTAEFSRIYIYVPDPDVPFLESLIPFGYHVLSGYDEMEIQCRVSDPNA
NVTLINSDTQQPVPSIYDSKRGALGIFTAGTYVCKAVINGHEFYSEEYIVHGSTDELDVE
LTAKKTALLVGDTITVTCVARGSEILEDHWKYPGKLANRGTKTVRENKRTQEIFYTLTIP
QASTKDSGIYSCSITDILSNSGQTKQLAIQVYASEFLSVKPEFREYESAALDEVREFKAV
VNSFPSVHVSWFKDGYPLSDVTAEISTSLQQTSEISYMSVLTLIRAKEEDSGNYTMRVEN
RNQSRDISLILEVKVPAVIVDLMDVHHGSAQGQSVVCITRGQPTPMVEWFVCKNIKHCAN
DSSSWVPIPANSTEITLDSHIDEDNNLESQVMFGHLESTMAVRCLARNEMAVVSREVKLV
SNGPHPELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEYIYVDP
MQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSE
KQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRENFLSLN
PEKNKKELDIFGINPADESSRSYVILSFESKGDYMDMKQADSTQYVPMLEMSNASKYSDI
QRSNYDHPPSQKGSSEGEMEIMLSDDVNEGLTTTDLLSFTYQVAKGMEFLASKNCVHRDL
AARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVW
SYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPHDVYEMMMKCWNSEPEK
RPSFLGLSETVASLLPSSYKRQYERVNHEFLKSDHPAVTRVCMENEDYIGIAYKNQGKLK
DRESGFDEQRLSSDSGYIIPLPDLDPISDEEYGKRNRHSSQTSEESAIETGSSSSTFAKR
EGETLEDITLLDEMCLDCSDLVEDSFL
NT seq 4404 nt   +upstreamnt  +downstreamnt
atggattggctgaagacgtttgtcctctttgggggcagtttggtggttttggtttcagtt
acctctggactgcttccaccaaccatcttgtctgaccaggaggagtttgtcctacagcct
aattccctcttcaatataagctgcaccgctaaaacacacgtggtttgggaggaaccgctg
cagaaaaacgccctggtttatccggggtattacacttcaacactcttcatatacaacgca
acggtagaaaacacaggttattacacgtgcaaatatgaagacccggatgaagaactggaa
gctgatgaagcagaaatttatatttttgtcccagatccacatgctccatttgtccccgag
ttacccacagacctggttgtctccgtggacaattatggattcaacatcccatgtcgtgtg
tctcactgggactcctacgtcatcctgagaaaagtccccagtggagaggctttgcatgcc
ttatacaacagcaaagaagggttcttctcaaacaacctaactcccgggcagtaccagtgt
gaaaccactctgaatggccagatagtccgaagttctatttacactgtaatatctaatgac
cctatggaggggaaggattttgacgattctgacatggaggtaatagccagtgaagagacg
ttgcgagcagggcagcctttcaacatcacatgcatcgttccttctggcctggactttcaa
cagcagtggctccatcctaaaaaacaggctaaggatgcagttttgatgaaggaaactttt
cctgagcgggtcgcctacatcctcagtatcccacgagccgcctcacaggacagtggcacc
tatgagtgctctgttacagacaaaagcggtgaggtcagagtcaaaaaggtggctgtgacc
gtctttgaggagaattcctttgtggccatggaccacagtgggattttatccacagaattt
gtccacagttttgaggagacagagtttactatcattattgatgcatacccagcccccaaa
gtgacatggatgaaagatggcaaagacttacaagtgaactactacctctttactactact
agccaccagggaggaaatcggtatctgagcactttgaaattcaggcatcctctggaaaaa
gacaatggaaattataccataattgctcaaagtggctctcacactgctcagttctccttt
aacctgcacatgaaagctcccactgcagggatgatcccatcatcttcagtccctctgctg
ctgccaaagctggacgagatggtagttactctccacacccctttcaccttgacctgtcat
ggacaggaaaacctgggctgggagacgccaatcgatgtatctgagcaaacgcaggaggac
cccaacggcttgtttatcagcaccatcacagtggatagtgccacagcaagccacactggc
tactacacgtgcttttatagtagaactttcgctgaggatacagcagaatttagcagaatc
tacatttatgttccagaccccgatgtcccctttctggaatcactgataccttttggctac
cacgtcctgtctggatatgatgagatggagatccagtgtcgagtgtctgatccaaatgct
aacgtgactctgattaacagtgacacccagcagcctgtgcctagtatttatgacagcaag
aggggcgctttggggatattcactgctggaacctatgtctgcaaggccgtcataaatgga
cacgaattctacagcgaggaatacatcgtccatggctcgacagatgagctggatgttgag
ttgacagcgaaaaagactgctctgctggtgggcgacacaataactgtcacctgtgtggct
cggggatctgagattctggaagatcactggaagtatcctggcaaactggcaaatcgtggt
acaaaaacagtgcgagaaaataagagaactcaggagatcttttataccctgaccatccca
caagcttcaaccaaagacagcggcatctattcttgctccatcactgacatactgagtaac
agtggccagacgaaacaactagctattcaagtttatgcaagtgagttcttgtccgtcaag
ccagagttcagagaatacgaatctgcagcgctggatgaagtccgggagttcaaggctgtt
gtcaactccttcccaagtgttcatgtcagctggtttaaagatggctacccactcagcgat
gtgactgcagagatctccaccagcctccagcagaccagtgaaatcagctacatgagtgtt
ctcaccctgatccgagccaaggaggaggacagcgggaactacaccatgcgggtggagaac
agaaaccaaagtcgtgatatcagtttaatccttgaagtcaaagtgcctgcagtcattgtt
gatctgatggacgtccaccatggctcagctcaaggccagtctgtggtttgcattaccaga
gggcagccgacacccatggtggagtggtttgtctgcaagaatatcaaacattgcgctaat
gattcgtcttcgtgggtgcccatccctgccaactccactgagatcacattggactcacac
attgatgaagacaataacctggagagccaggtcatgtttggtcatctggaaagcacaatg
gcagtgcgctgcctggccaggaacgaaatggctgttgtcagcagggaggtcaaactggtg
tccaatggccctcaccctgagctgactgtagctgctgctgtgctggtgctcctggtcatt
gtcatcatctcactcattgtcttggttgttatctggaaacagaaaccacgatatgaaatc
cgctggagggtcatagaatctgtgagcccagacggtcatgagtacatctatgtggatccc
atgcagcttccctatgactcgagatgggagtttccccgtgacagacttgtgcttggtcgt
atcttgggctctggagcctttgggaaggtggtagagggcaccgcctatggactcagccgc
tcgcaacctgtcatgaaggtggcagtgaaaatgctgaaacccacagcacgctccagtgag
aaacaggccctgatgtctgaactcaagatcatgactcatcttggaccccatctcaacatt
gttaacctcctgggagcatgcaccaagtcaggccctatctacattatcactgagtactgc
ttctatggggacctggttaactatctgcacaagaacagggagaacttcctcagtctgaac
cccgagaagaacaagaaggagctggacatctttggaatcaaccctgcagatgaaagcagc
aggagttatgtgatcctgtcatttgaaagcaaaggggactacatggatatgaagcaggct
gacagcactcagtatgtgcccatgctggagatgagcaatgcctccaagtactcagatatc
cagcggtctaactatgaccatccaccctcgcagaaaggctcgagtgaaggtgaaatggaa
atcatgctgtcagacgacgtaaatgaaggcctcaccaccactgacctgctcagctttacc
taccaggtggccaaaggcatggagtttcttgcctccaaaaattgtgtacatcgagacctt
gcagccaggaatgtccttctctctcagggcaagatagtgaagatctgtgactttggactg
gctagagacatcatgcatgacaacaactatgtgtccaaagggagcacttttctcccggtg
aagtggatggcaccagagagtatttttgataacttgtacaccactctgagcgacgtctgg
tcttacggcatcctcctctgggagatattctccctgggtggcaccccgtacccagggatg
gtggtggactcgagtttctacaacaagatcaagagtggatacaggatgtcaaaaccagag
cacgcacctcatgatgtgtatgagatgatgatgaagtgctggaacagtgagccagagaag
aggccatctttcctgggtctgagtgaaacagtagcttcgttgttaccctccagctacaag
aggcaatacgaaagagtaaaccacgagttcctgaagagcgaccaccctgctgttactcgg
gtatgcatggaaaatgaggactacattgggatcgcctacaaaaaccaggggaagctgaag
gacagagaaagtggcttcgatgaacagcggttgagctctgacagtggctacatcattccc
cttcctgacctggaccctatatctgacgaagaatatggaaagaggaacagacacagctct
caaacatctgaagagagcgccattgagacaggctccagcagctccacctttgctaagcgc
gagggtgagactctggaggacatcacgctgctggatgagatgtgtctagactgtagtgac
ctggtggaagacagctttctgtga

DBGET integrated database retrieval system