KEGG   Oreochromis niloticus (Nile tilapia): 100692602
Entry
100692602         CDS       T06104                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04068  FoxO signaling pathway
onl04217  Necroptosis
onl04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100692602 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100692602 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100692602 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:onl03000]
    100692602 (stat3)
Transcription factors [BR:onl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100692602 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N
Other DBs
NCBI-GeneID: 100692602
NCBI-ProteinID: XP_013125075
Ensembl: ENSONIG00000001148
UniProt: I3IXW4
LinkDB
AA seq 784 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMDIARIVARCLWEEQRLLQTAT
SATQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDEE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFADIIMGYKI
MDATNILVSPLVYLYPDIPKEEAFGKYCRPEAAPEAEMGGDSTSTIQPYLKTKFICVTPC
PSVFMDLPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEATPGHMDSLTLEMDV
ASPM
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggcccagtggaaccagttacagcagctggagaccaggtacctggagcaactctaccac
ttgtacagtgacagcttccccatggagttacgacagtttcttgcgccttggattgagagt
caagactgggcttacgctgccaataaggagtcacatgctacactggtgttccacaacctc
ttgggagaaatagatcagcagtacagccgtttcctgcaggagaacaatgtgctctaccag
cataacctacgcaggattaaacagcatctgcagagcaagtacttggagaaaccgatggat
attgctcgcattgttgctcgctgtttgtgggaagaacagaggctgctgcagactgccacc
tctgctacacaggatggccaggcagcccatcccactggaacagtagtgacagagaagcag
cagatactggagcacaatcttcaagacatcaggaagcgggtgcaggatatggaacagaag
atgaaaatgcttgaaaacttgcaagatgactttgatttcaattacaagaccctaaaaagc
caaggagagttgtcccaggatctaaatggaaatagccaggcagctgcaacgaggcagaag
atggcccagctcgagcagatgctgagcgccctggatcagctcaggaggcaaattgttacg
gagatgggaggcttgctgactgccatggactacgtacagaagaatctgacagatgaagaa
ctggctgactggaagaggagacagcagattgcttgtattggaggccctccaaacatctgt
ctcgatcgccttgaaacttggattacgtccttggctgagtcccagctccaaattcgtcag
caaatcaagaagctggaagagcttcaacagaaggtgtcctacaaaggagaccccatcatt
cagcaccggcccgcacttgaggagaaaattgtggacttgttcagaaacctaatgaagagt
gcttttgtggttgaaagacagccttgcatgcccatgcatccggacagacctctggttatc
aaaacaggcgtgcagttcacaaataaagtcaggttactggtaaagtttcctgagctcaat
taccagctgaaaattaaagtttgcattgataaggaatctggtgatgtggctgcaattcga
ggatcacgaaagtttaacatcctcggtactaacacaaaagttatgaacatggaggagtcc
aacaatggtagcctgtcagcagagtttaaacacttgaccctgcgagaacaaaggtgtggt
aatggtggacggaccaatagcgatgcctctctgattgtcactgaggaactgcatcttatc
acatttgaaacagaggtctatcaccagggcctgaagatagatctggagacccattccctg
cctgtggtagttatatcaaacatctgccagatgccaaatgcctgggcttcaatcctgtgg
tacaacatgctcactaaccacccaaagaacgtgaacttcttcaccaaacctccagtgggg
acatgggaccaggtggctgaggtgttgagctggcagttctcttccaccaccaagcgaggc
ctgaccattgaacagctcaccacattggctgagaaattactaggaccatgtgtcaactac
tctggatgccaaatcacctgggccaagttctgtaaggaaaacatggcaggcaaaggcttc
tccttctgggtgtggcttgacaacattattgacctggtgaaaaagtacattcttgcactg
tggaatgaagggtatatcatgggttttatcagtaaggagagggagagggctattctgagt
ccaaaacctcccggtacttttctgctgcgcttcagcgagagcagcaaggaggggggcatc
acctttacatgggtagagaaagacatcagtggaaagacccagatccagtcagtggagcct
tacaccaagcagcagctcaacagcatgtcgtttgctgacatcatcatgggctacaagatt
atggatgccaccaacatcctggtttcacctcttgtctacctatatcctgatattcccaaa
gaggaagcctttgggaaatactgcaggccagaagcagctcctgaagccgagatgggagga
gactcaacgagcactattcagccttatttgaagacaaagtttatctgcgttaccccgtgt
ccctccgtcttcatggacttgccggacagtgagctgcttgggaacggattcccaggcaca
aactctggaaacaccagtgacctgttccccatgtcaccccggacccttgactccctgatg
cacaacgaagctgaagctactccagggcatatggattcactcactttggaaatggatgta
gcatcgcctatgtga

DBGET integrated database retrieval system