KEGG   Oreochromis niloticus (Nile tilapia): 100693266Help
Entry
100693266         CDS       T06104                                 

Definition
(RefSeq) N-lysine methyltransferase SMYD2
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00310  Lysine degradation
onl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100693266
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:onl03036]
    100693266
Enzymes [BR:onl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     100693266
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     100693266
Chromosome and associated proteins [BR:onl03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100693266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-MYND TPR_12
Motif
Other DBs
NCBI-GeneID: 100693266
NCBI-ProteinID: XP_003449905
Ensembl: ENSONIG00000013514
LinkDB All DBs
AA seq 440 aa AA seqDB search
MTPRAGSTMTGSIEGLERFDSPGKGRGLRVTRPFKVGELLFSCPAFSHVLSVKERGCYCE
FCFTRTQHLARCGKCKKAFYCNVKCQKGDWAMHKLECSAMVAFGENWCPSELSRLVARIL
AKKKMQKERCICEKMLLIGEMQSHTEDEDNEKREMTEADIAGLHRFYSKHLDVPDHKELL
TLFSQVACNGFTIEDDELSHLGTAVYPDMALINHSCLPSVIVTFKGTSAEVRAVQDMKPG
DEVLISYIDLLYPTDDRNNRLRESYYFICDCQECKSQSKDKAKLKVRKQRDSIEPDVINN
MVRYARKAIREFREFKHTKTPSELLEMCEQSLEEMGAVFDDSNVYMLHMMYQAMGICMYM
QDLDGAIRYGEKLLKPYSHLYPPYSLNVSSVYLKLGRLYLGLERQSACTSALKKAMAIME
VAHGKDHFYIEELRKMIAQK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgacaccccgggcaggaagcacaatgacgggcagcatcgaaggactggagaggtttgac
agcccggggaagggacgagggctccgggtaaccagaccatttaaagttggagagctcctg
ttttcctgccctgccttctcccacgtgctgtcagtgaaagagagaggctgctactgcgag
ttctgcttcaccaggacacagcatttggcaagatgtgggaagtgcaagaaagccttctac
tgcaacgtgaaatgtcagaaaggagactgggccatgcacaagctggagtgttcagcaatg
gttgcttttggagagaactggtgcccgtcagagttatccaggctggtggcgcgaatcctt
gcaaagaagaaaatgcagaaagaacgatgcatttgtgagaagatgttgctcataggagag
atgcaatcacacacagaggacgaagataatgagaaaagagagatgaccgaggcagacatt
gccggattgcatcgcttttactccaaacatttggatgtgccggaccacaaagaactactc
acactcttctcccaggttgcctgcaatggtttcactatagaggatgatgaactttcccac
ttgggtactgcagtctatccagacatggccctgataaaccacagctgccttcccagcgtc
atagtcacgttcaaagggacatcggctgaagttcgggcggtgcaggacatgaaacctgga
gatgaagtgcttatcagctacatagacctcctctacccaacagatgaccgcaataacagg
ctgagagagtcctattactttatctgtgactgccaggaatgcaaaagccagtcaaaggac
aaggcaaagttaaaagtacgtaagcagagggattccattgagccagatgtcatcaacaac
atggttcgctacgcccggaaagctatcagagagttccgggaattcaaacacacaaagacc
cctagtgagttgctggagatgtgcgagcagagtctggaggaaatgggagccgtgtttgat
gactccaatgtgtacatgctccacatgatgtaccaagccatggggatttgcatgtacatg
caagatctagatggagctatcagatatggcgagaagcttctcaaaccttacagccatctc
tatccaccttactcccttaacgtgtcgtccgtctacctgaaactgggccgattgtacttg
ggcctagagaggcaatcagcatgcaccagcgctctaaaaaaggcaatggctataatggag
gtggctcatgggaaggatcacttttacattgaagagctgcgtaaaatgatagcacaaaaa
taa

DBGET integrated database retrieval system