KEGG   Oreochromis niloticus (Nile tilapia): 100693391Help
Entry
100693391         CDS       T06104                                 

Definition
(RefSeq) lysophospholipid acyltransferase LPCAT4 isoform X2
  KO
K13512  lysophospholipid acyltransferase [EC:2.3.1.23 2.3.1.-]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00564  Glycerophospholipid metabolism
onl00565  Ether lipid metabolism
onl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100693391
   00565 Ether lipid metabolism
    100693391
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:onl01004]
    100693391
Enzymes [BR:onl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     100693391
    2.3.1.-  
     100693391
Lipid biosynthesis proteins [BR:onl01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   100693391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase EF-hand_6
Motif
Other DBs
NCBI-GeneID: 100693391
NCBI-ProteinID: XP_003458815
Ensembl: ENSONIG00000000292
UniProt: I3IUS7
LinkDB All DBs
AA seq 508 aa AA seqDB search
MERIDDGYSATQEYPHPFIHKVKLTRAQRIRGIILGSILFPIRVTLAGVCFLIMWPIARL
RLAGLSEEERSKPVEGWRRWFYHPIIWLLSRAVFFSLGFYWVKVKGRRANLKEAPVLVVA
PHSGFLDMLVLCPAQLATVVSRSENTSLPVIGALLEFNQSVLVSRKDPESRKKAVAQLNE
RLTSDGYWPQMLMFPEGTTTNGSALIKFKPGAFLAGVPVQPVLLHYPNKLDTVRWTYKGT
AWTEALWHTVSQPYTNMTVEFLPVYNPSQEEKKDPNLYADNVQKLMARALGVPATDYVME
GGVPVSKVGGLSLPLESPARETVTLLHKSGLGAHEVQAALDRMIDRCCSGAQGAKVIAEE
LASILGLSHQQTAAHICSLYSKDHSVDLRHIYFSVAPLTGCVDLKTLLHSAFTMFNREGR
GSLSERELSDLMEALLGVPQHRVAELYAAASDRSRLTEESLLRVLTAHPTFQKVTKEYLR
PEEAAGTLSNGRYVNNNGSVYSNSKKSE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggagaggatcgacgacggttactcggcaacgcaggagtatccacatccgttcattcac
aaagtgaagctgaccagggcgcaaaggatccggggtatcatcctcggcagcatcctcttc
cccatacgcgtcaccttggcgggcgtttgcttcctcataatgtggcccatcgcccggctg
cgattggccggcctgtccgaggaggagcgctccaaacccgtggaaggctggcgccgctgg
ttttaccacccaatcatctggctgctgagcagagctgtgttcttctccctgggtttctac
tgggttaaggtcaaaggtcgcagggcgaacctgaaggaggcgccggtgctggtcgtggcg
ccccacagcggctttctggacatgctggttttgtgcccggcccagctggcgacggtggtg
tcgaggtctgagaataccagcctgccggtcataggagctctgctggagttcaaccagtct
gtgctggtgagcaggaaggatccagagtcgaggaaaaaagctgtcgctcagctcaatgag
aggttgacctccgacggctactggcctcagatgctgatgtttcccgaggggaccacgact
aacggcagcgctctcatcaaattcaaacccggtgccttcctcgccggagttcctgtccaa
cctgtgctgctgcattaccccaacaagctggatactgttcgctggacatacaaaggcaca
gcctggaccgaggctctgtggcacacggtgtcccagccgtacaccaacatgactgttgag
ttcctgccagtttacaacccttcacaggaggagaagaaggaccccaacctgtacgcagac
aacgttcagaaacttatggccagggcccttggagtccctgctacagactacgtgatggag
ggtggggttcctgtcagcaaagtcggcggtctgtccctcccgctggagtctccagccaga
gaaacagtgacgctgctgcacaaaagcggtctgggagcgcatgaagtacaggcggctctg
gacaggatgattgacaggtgttgctctggagctcagggcgcaaaggtcatcgcagaggag
ctcgcctccatcctcgggctgagccaccagcagacagctgcccacatctgcagcctctac
tccaaggatcactctgtggacctgaggcacatctattttagtgtcgcacccctgactgga
tgtgttgacctgaagacgctgcttcactctgctttcactatgtttaacagagagggtaga
ggcagcctgagcgaaagggagctgtcagacctgatggaggcgctgctgggtgtccctcag
cacagagttgccgagctctacgcggccgcctccgatcggagccggctcactgaagagagt
ctgctgcgggtgctgactgcccacccaacctttcagaaagtgacgaaagagtacctgagg
cctgaggaggctgcaggtactctgtccaacgggaggtatgtgaacaacaacggatccgtt
tacagcaacagtaagaagtctgaatga

DBGET integrated database retrieval system