KEGG   Oreochromis niloticus (Nile tilapia): 100693650
Entry
100693650         CDS       T06104                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04080  Neuroactive ligand-receptor interaction
onl04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100693650
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100693650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:onl04030]
    100693650
G protein-coupled receptors [BR:onl04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    100693650
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF1634 DUF4752
Other DBs
NCBI-GeneID: 100693650
NCBI-ProteinID: XP_005461723
Ensembl: ENSONIG00000003833
UniProt: I3J7I6
LinkDB
AA seq 365 aa
MGNITDTCHDSEKIDFFYNNSGKPINTEWNKRDYVIVTLGMIVCFIVIFSNFLVIAAIFK
NRRFHFPIYYLLGNMALADLFAGFAYLHMMFHTGPWTIKLSLSQWFTRQGLINTSLTASV
LNLLFVAVERHQTIFNVQLHSSMSTRRVFIIVLLIWLVAIIMGLVPQMGWNCTCHLSKCS
TMAPLYHRSFLIFWAVLNLITFSIMLAVYTRIFLYVRHKGRQMSQHTSTTRQRETMMNLM
KTVSMILGCFVVCWTPALVVLLLDGLNYDKSLVLGLEKYCLVLAECNSFVNPIIYCFRDQ
DMRRTFKEILCCNWSQSHKNRGFSEVKFHTVEQENGKSRIPKAIERSNGTPLIHASSEDI
PERSD
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgggtaacataaccgacacatgccacgacagtgagaaaatcgattttttctacaacaac
agtggaaagcccatcaacacagaatggaacaagcgtgactatgtgattgtaaccctgggc
atgatcgtttgcttcattgttattttttccaactttttggtcatagcggccattttcaaa
aacagacggtttcactttcccatctactacttgttgggtaatatggctttggcagacctc
tttgcaggttttgcttatctccacatgatgtttcatactggtccctggactataaagcta
tcgctgagccagtggtttactcgtcaggggttgataaataccagcctgacagcctccgtc
ctcaacctcctcttcgtggctgtggagcgccaccagactatcttcaacgtccagctccac
agcagcatgagcacccggcgtgttttcataatcgtgctgttaatttggctggtggcaata
atcatgggcctggttcctcaaatgggttggaactgtacgtgccatctgagcaaatgctcc
accatggcaccgctgtaccaccgcagcttcctgatattctgggcggttcttaacttaata
accttctccatcatgttggccgtatacacccggatctttctctatgtgaggcacaagggc
aggcagatgtcacagcacacctcaacgacgagacagagagaaaccatgatgaacttgatg
aagaccgtctccatgatcctgggctgctttgtggtctgctggacgcccgcactggtcgtg
ctgctgcttgatggtctgaactatgacaagagtttggtgctaggcctcgagaaatactgc
ttggtgctggcagagtgcaactccttcgtcaaccccatcatctactgcttcagggaccaa
gacatgaggaggaccttcaaggagatcctgtgctgcaactggtctcagagccacaagaac
agaggcttctctgaagttaaatttcacaccgtggagcaagagaacggtaagtctcgtatc
cccaaggcgatagagaggagcaacgggacgcctctcatccatgccagctcagaggacatc
ccagaaaggtctgattaa

DBGET integrated database retrieval system