KEGG   Oreochromis niloticus (Nile tilapia): 100693706Help
Entry
100693706         CDS       T06104                                 

Gene name
gamt
Definition
(RefSeq) guanidinoacetate N-methyltransferase
  KO
K00542  guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00260  Glycine, serine and threonine metabolism
onl00330  Arginine and proline metabolism
onl01100  Metabolic pathways
Module
onl_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100693706 (gamt)
   00330 Arginine and proline metabolism
    100693706 (gamt)
Enzymes [BR:onl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     100693706 (gamt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 MTS
Motif
Other DBs
NCBI-GeneID: 100693706
NCBI-ProteinID: XP_003449070
Ensembl: ENSONIG00000012685
UniProt: I3K4C3
LinkDB All DBs
AA seq 235 aa AA seqDB search
MTTSAQPIFSKGEDCKATWHDASAGYNEADTHLEIMGKPVMERWETPYMHSLATVAASKG
GRVLEIGFGMAIAATKLESFPIEEHWIIECNDGVFARLENWAKSQPHKVVPLKGLWENVV
PTLPDNHFDGILYDTYPLSEETWHTHQFDFIKGHAHRLLKPGGVLTYCNLTSWGELLKTK
YDNIEKMFEETQVPHLVEAGFKKEKISTTTMDIEPPSECKYYAFCKMITPTIVKE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctctgctcagcccatattctcaaagggagaggactgcaaggccacctggcac
gacgctagcgcgggctacaatgaggccgacacgcacctggagatcatgggcaagcctgtg
atggagcgctgggagacgccatatatgcactccctggccactgttgctgcctcaaaaggt
ggtcgggtgctggagattggtttcggcatggccatcgctgccaccaaactcgagtctttc
cccatcgaggagcactggatcatcgaatgcaacgatggagtcttcgcccgcctggagaac
tgggcaaagtctcagccacacaaggtcgtccctctgaagggcctctgggaaaatgttgtc
cccactctgccagataaccactttgatggtatcctgtatgacacataccctctgtcagag
gagacatggcacactcaccagtttgatttcatcaagggtcatgctcacaggctgctgaaa
cccggtggcgtcctcacctactgcaacctgacctcctggggcgagctgctcaagaccaaa
tacgacaacattgagaaaatgtttgaggagacccaggtgcctcatctggttgaagcaggc
ttcaagaaggagaagattagcaccaccaccatggacattgaaccacccagtgaatgcaaa
tactatgccttctgcaagatgatcactcccactattgtaaaagaataa

DBGET integrated database retrieval system