KEGG   Oreochromis niloticus (Nile tilapia): 100693787
Entry
100693787         CDS       T06104                                 

Definition
(RefSeq) putative fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100693787
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100693787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:onl04052]
    100693787
   00536 Glycosaminoglycan binding proteins [BR:onl00536]
    100693787
Cytokines and growth factors [BR:onl04052]
 Growth factors
  Growth factors (RTK binding)
   100693787
Glycosaminoglycan binding proteins [BR:onl00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100693787
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100693787
NCBI-ProteinID: XP_003446003
Ensembl: ENSONIG00000017912
UniProt: I3KN82
LinkDB
AA seq 154 aa
MADGDTVEDLSVGDSGPLQLRDYRRLARLYCMNGGHHLQILPDGTVQGQREESDAHTVLK
LKAVDRGVVVIQGTEASRYLAMSDEGRLYSSPTVTDECYFLERLEENHYNTYQPQKYHDN
NWYVALKKNGKPKLGPRTHIGQKAVFFLPRQLDD
NT seq 465 nt   +upstreamnt  +downstreamnt
atggcggatggagacacggtggaggatctgagtgtgggagacagcggcccgctgcagctg
agggactaccggagactggctcggctgtactgcatgaatggcggacatcacctccagatc
ctccccgacgggacggtgcagggccagagggaagagagtgacgctcacactgttttaaag
ctcaaagctgtggacagaggcgtcgtggtcatccaaggaactgaagccagcagatattta
gccatgagcgatgaaggccgtttgtacagttcacccacagttacagatgaatgttacttc
ctggagaggctggaggagaaccactacaacacataccagccacagaaatatcacgacaac
aactggtacgtagctctgaaaaagaacggaaagcctaaactcggcccgagaacccacatc
ggacagaaagccgtcttctttctccccaggcagctggatgactga

DBGET integrated database retrieval system