KEGG   Oreochromis niloticus (Nile tilapia): 100695337
Entry
100695337         CDS       T06104                                 

Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
onl  Oreochromis niloticus (Nile tilapia)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 C1_2
Other DBs
NCBI-GeneID: 100695337
NCBI-ProteinID: XP_003454612
Ensembl: ENSONIG00000014466
UniProt: I3KAP3
LinkDB
AA seq 359 aa
MSKCELIELQDLSVNDPIELAAPAVHVAPSTGNLGHPSHYCVVRLVGDNVSIEAPGHHTG
ETGVGHDFQPYSHAHLTWCDLCGEFIWGLYKQSLRCTNCSYTCHYRCRPSIQLDCMTHGS
LLAEHAALSDDCIETDTNVDEQIELGKQELNVSEIQQKVKEYNAQISNNLYMVDNKDGSY
TGFIKVHFQLVRPISLPPPRQSLSLMQEDDYQGRRMKRRTSFYLPKDAAKHLHISSETRV
REVIEALLNKFTVVDNPAKFALFERTERQGQVYMRKLSDDERPLYLRLCAGPSETVLSLV
LKENETGDVNWHAFSFPELCNFLRILQREEETHVREIVKRYALARDMMNQAMARMTTPG
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtctaaatgtgagctgatagagctgcaggatctcagtgtaaatgatcccatcgagctg
gccgctccagctgtccatgtagccccgtcgactggaaacctgggtcatcccagccactac
tgtgtcgtccgtctggttggagacaacgtcagcattgaggcccctggtcatcacacagga
gagactggtgtgggtcatgatttccagccctacagtcatgcacatctcacctggtgtgac
ctgtgtggtgaattcatctgggggctttataaacagagtttacgctgcaccaactgcagc
tacacttgtcactaccggtgtcgaccgtccatccagctggactgcatgacacatggaagt
ttgttagcagagcatgcagctttatctgatgactgcatcgagacagacacaaatgtggat
gaacagatcgagttgggtaaacaggagttaaatgttagtgagattcaacagaaggtgaag
gaatacaatgctcagatcagcaacaatctctacatggtggataataaagatgggtcctac
actggtttcatcaaggtccactttcagttagttcgtcccatttccctccctcctcctcgt
cagagtttgagcttgatgcaggaagatgattatcagggaagacggatgaaacggcggaca
tcattctacctccccaaagatgctgcaaagcacctacatataagctctgaaacacgggta
cgagaagtcatcgaagcactgctcaataagttcaccgttgtggacaacccggcaaagttt
gccttgtttgaacgcacagagagacaaggtcaagtgtacatgcgtaaactgtctgatgat
gagcgtcctctgtacctgcgcttgtgcgctggccccagtgaaacagtcttaagcctggtt
ctgaaagagaacgagacaggggatgtaaattggcatgcatttagctttcctgagttgtgc
aacttcctgcgaatcctccagcgggaggaagaaacacacgtaagagagatcgtgaagcgc
tatgctcttgctagagacatgatgaatcaagccatggcccggatgactacaccgggttga

DBGET integrated database retrieval system