KEGG   Oreochromis niloticus (Nile tilapia): 100699059Help
Entry
100699059         CDS       T06104                                 

Gene name
wdhd1
Definition
(RefSeq) WD repeat and HMG-box DNA-binding protein 1 isoform X1
  KO
K11274  chromosome transmission fidelity protein 4
Organism
onl  Oreochromis niloticus (Nile tilapia)
Brite
KEGG Orthology (KO) [BR:onl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:onl03036]
    100699059 (wdhd1)
Chromosome and associated proteins [BR:onl03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    100699059 (wdhd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mcl1_mid WD40 ANAPC4_WD40 HMG_box eIF2A HMG_box_2
Motif
Other DBs
NCBI-GeneID: 100699059
NCBI-ProteinID: XP_005458950
Ensembl: ENSONIG00000007084
LinkDB All DBs
AA seq 1130 aa AA seqDB search
MPCERKPMRYGHSEGHTEVCFDDTGRFIVTCGNDGDVRIWESLDDDDPKFITVGEKAYSL
ALKNGKLVTASSNNTVQIHTFPDGDPDGILTRFTTNATHVTFNSIGSRVAAGSSDFMVKV
VEVSDSSQQKTLRGHEAPVLSVTFDPKDDFLASASCDGSVVVWNIEEQTQVISWPLLQKS
NDVTNAKSLCRLAWQPGMGKFLAVPVETKVHLYERGSWDHVSTLSDDLLTQPINVVSWSP
CGRFLAAGSVGGLLTVWDVNSKLCVERQKHEKGFTVCSLAWHPSGSQIAYTDTEGCLGLL
DGLGTSTADKNTTKQVAAKKPAKDYDDLFDDDDDRLMDEGLSDTKSPAKKAVGWDDDDDD
FLVPATGRVKNRGAFLDDENSLDTGSLKLGQDKFGDNNDDAGSSVAPAAPPVAPLRPVYE
GPMPTPPQKAFQPGSSPAHLTHRFMMWNFVGIVRGYNDEQDNAIDVEFHDTAVHHAMHLT
NSLGHTMADLSQEGVLLACPSTEELASKLQCLHFSSWDTNKEWMVDLPKGEDARALCLGQ
GWAAVATSTLMIRLFSIGGVQRELFSLPGPVVCMAGHGEQLLVVYHRATGFDGEQALGVQ
LLQFSRKKRQLISGEPLPLSQKSYLSWLGFTAEGTPCYVDSNGMVRMLNRSLGNTWTPVC
NTRETCKSKSDHYWVVGVHENPQQLRCIPCKGSRYPPTLPRPAVAILPFKLPLCQTTTEK
GQMEEQFWRSVLFHNHYSFLSSSGYEIDEDAQNLSQKEQQELLMKMFALSCKLEREFRCV
ELAEMMTQNVVTLAIRYASRSRRMALAQRLSEIALEKSNQMQEEEQEEPEYSSTRRSSGY
GHTNVMAGGRYSRRHNQQEEEEDEEERGEELMEEEDGQEMEPEEATETKKRVNPFAKEAS
SPIKPSPTPIGKMGRANPFKVPDSGKMSASSGQPRVTNILDNMMSSKKSAQLSSSGGKPS
KSPVLKPLAPKPKTKTQSTLLQMAATKTANKKAQENTEPAANLQKRPDTPPPAPPADNSE
NKRPKTGFQLWLEENRKSILADNPDLEETDVIKEAMGRFRTLSTEERLSWTERAKGQSGD
AADLKKRKRAEGGEGLENENEKAEADESSAKKKKSLDPSSKLSVFAFNQN
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgccatgtgaaaggaagccgatgcgctacggccactctgaaggacacaccgaggtgtgc
tttgatgacactgggaggttcattgtaacctgcggaaatgatggagatgttcggatctgg
gagagtctggatgatgacgatccaaagtttatcaccgttggggagaaggcttattctctg
gcactgaagaatggcaaactggtaacagcgagctccaacaacactgtgcagatccacaca
tttcctgatggcgatccagacggcatcttgacccgcttcaccaccaatgccacacacgtc
accttcaacagcatcggctcgagagttgctgctgggtccagtgacttcatggtaaaggtg
gtggaggtgtcagacagcagtcaacagaaaaccctcaggggtcacgaggcacctgtcctc
agcgtcacctttgaccctaaagatgacttcttggcctctgctagctgtgatggctctgtg
gtggtgtggaatattgaggagcagactcaggtgatcagttggcctctgctgcagaagtca
aatgacgtcactaacgccaagtctctgtgtcgtttggcctggcagcccgggatgggaaag
tttttagctgttccagttgaaaccaaggtacacctgtacgagcgaggctcctgggaccac
gtgagcactctgtctgatgatctgctcacacagcccatcaacgtggtgtcttggtctcct
tgcgggcgtttcctggcagctggcagcgtggggggtttacttacagtgtgggatgtgaac
agcaagctgtgtgtggaaaggcagaaacacgagaaaggcttcacagtgtgcagtttggcc
tggcatccatcaggcagccagattgcctacacggacacagagggctgcctgggcctgctg
gacggactcggcacctccacagctgacaagaatacgaccaagcaggtcgctgcaaaaaag
cctgcaaaagactacgatgatctgtttgatgatgacgatgacagactgatggatgaagga
ctgagtgacacaaagtctccagctaagaaagccgttggctgggatgatgacgatgacgat
ttcctggtgcctgcgactgggcgggtgaagaacagaggagcgttcctggacgacgagaac
tcactagacacaggatcactgaagctcggtcaggacaaatttggggacaacaacgatgac
gcaggtagttctgtggcgcctgcagcgcccccggtggcgcccctgcgtcctgtctacgag
gggcccatgccaactcctccccagaaagccttccagccgggctccagccctgcacatctc
acacaccgcttcatgatgtggaacttcgtggggatagtgcgaggctacaatgacgagcag
gacaatgccattgatgtggagtttcacgacacggccgtgcaccatgccatgcacctcacc
aactcactgggtcacaccatggctgatctctcccaggagggtgtgctgctggcctgcccc
agcacagaagagctcgctagtaagctgcagtgccttcacttctcctcgtgggacaccaat
aaggagtggatggtcgacctaccgaaaggggaggatgcgagggctctttgtctgggtcaa
ggctgggcagcagtcgccaccagcacgctaatgatcaggctcttctccatcggaggagta
cagagagaattgttcagcctgccggggcctgtggtctgcatggcaggacacggagagcag
ttgctcgtcgtctaccatcgggctacaggtttcgatggagaacaggctcttggtgtccag
ctgctgcagttcagtcgaaagaagaggcaactcatcagcggcgaacccctccccctctct
caaaagtcttacttgtcctggctcggcttcacagccgagggtaccccgtgctatgtggat
tcaaacggcatggtgcgaatgctgaaccgctccctgggcaacacgtggactccagtgtgc
aacaccagggagacctgcaagagcaaatcagatcactactgggtggttggagtgcacgag
aaccctcagcagctcaggtgtattccatgtaaaggctccaggtatcctcccaccctgccc
agaccggccgtggccatcctgcccttcaagctgcccctgtgtcaaaccacaacagagaag
gggcagatggaggagcagttctggcgttcagtccttttccacaaccactacagcttcctg
tcctccagcggctacgagatagatgaagatgctcagaatctgtcccagaaggagcagcag
gagctgctcatgaagatgtttgcattgtcctgcaaactggagcgagagtttcgctgtgtg
gagctggcagagatgatgacccagaatgtggtgactctggccatacgatacgcatcccga
tccagacgcatggccctcgcacaacggctcagcgagattgccctggagaaatccaaccag
atgcaggaagaagagcaagaggagcctgaatactccagcacgagacggagctctgggtat
ggccacaccaacgtcatggcgggaggacgttacagcagaagacataatcagcaggaggag
gaagaggatgaggaggaaagaggagaagagctcatggaggaagaggacgggcaggagatg
gagccggaggaggcgacagaaacaaaaaaacgtgtgaacccgtttgctaaagaagccagc
tcgcccatcaagccatctccgacaccaattggtaaaatgggacgtgcaaatccttttaag
gttcctgattcggggaaaatgtcagcttcatccggtcagccgcgagtaacaaacatcctg
gacaacatgatgtccagcaagaagtcagctcagctcagcagctctggggggaaacctagc
aaaagtcccgtcctcaaacctctggcccccaagccaaaaaccaagactcagtctactctg
ctgcagatggctgccacaaagacagctaataagaaggctcaggagaacacagagccagct
gcaaatctgcagaaacgaccagacaccccacctccagcaccacctgcagataactctgaa
aacaagaggccaaagacaggcttccagctttggttggaggagaacaggaagagtatccta
gccgacaaccctgacctggaagagaccgacgtcatcaaggaggctatgggacgcttcagg
acgctgtcgacggaggagagactgtcatggacagaaagagctaaaggccagagcggagac
gcagcagatctgaagaagaggaaaagagcagaaggaggagaaggcttggaaaatgaaaat
gaaaaggcagaagctgatgaaagtagtgccaagaagaagaagtctttggatccctcttcc
aagctttcagtgtttgcgtttaaccaaaactaa

DBGET integrated database retrieval system