KEGG   Oreochromis niloticus (Nile tilapia): 100699992
Entry
100699992         CDS       T06104                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00480  Glutathione metabolism
onl00980  Metabolism of xenobiotics by cytochrome P450
onl00982  Drug metabolism - cytochrome P450
onl00983  Drug metabolism - other enzymes
onl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100699992
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100699992
   00982 Drug metabolism - cytochrome P450
    100699992
   00983 Drug metabolism - other enzymes
    100699992
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:onl02000]
    100699992
Enzymes [BR:onl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100699992
Transporters [BR:onl02000]
 Other transporters
  Pores ion channels [TC:1]
   100699992
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin
Other DBs
NCBI-GeneID: 100699992
NCBI-ProteinID: XP_003440188
Ensembl: ENSONIG00000013188
UniProt: I3K639
LinkDB
AA seq 239 aa
MSAEKCLAKGSAAPGPVPKGYIRVYSMRFCPFAQRARLVLKAKGIKHEIINVHLADKPEW
YLKKNPFGIVPTLETPAGEVIYESPITCEYLDEVYPEKQLLPSSPFAKAQQRMMLEYFSK
MIGYFYRIPSGRKNGQDVSGLEAELKEKLSKLNEDLVNKKTKFFGGDSITMIDYMMWPWF
ERLEVFELQHCLDGTPELKMWTERMLEDPAVKATIHSIDAHKAFFKSYVEGKPDYDYGL
NT seq 720 nt   +upstreamnt  +downstreamnt
atgtctgctgaaaagtgtctcgctaaaggtagcgctgcacctggcccagtccctaaaggg
tacatcagagtttacagcatgaggttctgcccttttgcccagagggccagattagtgctg
aaagccaaaggaatcaagcatgaaatcataaatgtccatctggcagacaagccagagtgg
taccttaaaaagaatccatttgggattgtcccgacactggagacacctgctggtgaggtg
atatatgagtcaccgatcacctgtgaatacttggatgaagtttaccctgaaaagcagctg
cttccttcttctccttttgctaaagctcagcaaagaatgatgttggagtatttttccaaa
atgataggatacttttacaggatcccatcagggagaaagaatggtcaggatgtctcagga
ctggaagctgaactgaaagaaaagctttccaaattgaatgaggaccttgttaacaagaag
accaagttttttggtggtgattccataacaatgattgactacatgatgtggccgtggttt
gagagactggaggtctttgagctgcaacactgtctggatggcacacctgagctgaagatg
tggacagagcgcatgctggaagatccagctgtcaaagccaccatacacagcatagacgcc
cacaaggccttcttcaagtcctacgttgaaggaaaaccagactatgactatggcctgtag

DBGET integrated database retrieval system