KEGG   Oreochromis niloticus (Nile tilapia): 100703376Help
Entry
100703376         CDS       T06104                                 

Definition
(RefSeq) steroid 21-hydroxylase isoform X1
  KO
K00513  steroid 21-monooxygenase [EC:1.14.14.16]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl00140  Steroid hormone biosynthesis
onl01100  Metabolic pathways
Module
onl_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:onl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100703376
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:onl00199]
    100703376
Enzymes [BR:onl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     100703376
Cytochrome P450 [BR:onl00199]
 Cytochrome P450, animal type
  CYP21 family
   100703376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100703376
NCBI-ProteinID: XP_019220698
Ensembl: ENSONIG00000002824
LinkDB All DBs
AA seq 524 aa AA seqDB search
MEISIVSVGAAFLVVLLFMVLNWISGQKHKDVQENHKGSKSNDSRFLDQFLPCSSSLSLP
GPTSYFLIGNMMELKNDHLPIHLTNLAQRYGSIYRLKCGTTTMVVLNTSEVIREALVKKW
SDFAGRPISYTGNIVSGGGCNISLGDYTEKWRAQRRLVHSSLQRCCKKSLHDVIERQALH
LLKVLMGYKGHAVDLSEDFTVAASNVITTLAFGIEYDKSSSELQELHRCLNEIVALWGSS
WISALDSFPLLRKLPNPVFARLLKEVVRRDKIITRLLNNYKSQDEKNQDVITGSLLQGLD
NQNTGDKALLTDIHVHMATVDLLIGGTETSAAWLDWMVAFLLHRPEVQERVYEELCTVLE
GRYPKYSDRHRLPVLCSLISEVLRLRPVAPLAVPHRAIRDSSIAGYFIPKNTVIIPNLFG
AHHDPEVWPDPYSFKPERFLKEGGGSRGSSTRDLIPFGGGARLCLGESVAKMELFLFSAY
LLRDFQLLLPESETSLPDLRGVASVVLKIKSYKVVARPRPVTNP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatcaatagtcagtgtgggagctgcgttcctagttgtactgctgttcatggtg
ctgaattggatttctggtcagaaacacaaagatgttcaggaaaatcacaagggaagtaag
tcaaatgattctagatttctggaccagtttcttccctgctcctcatctctttccctccca
ggccctaccagctactttctaattggtaatatgatggagctgaaaaacgatcatctacca
attcacctcaccaatttggcacagcgctatggaagcatttatcgccttaaatgcggaaca
acaactatggtagtgctgaacaccagcgaagtcataagagaagcactggtgaagaaatgg
tctgactttgctgggagaccgatctcatacacaggtaatattgtgtctgggggaggttgc
aacatatctttaggtgactatactgaaaagtggagggcacaacgtcgccttgtccatagt
tctctgcagcgttgctgcaaaaagtctttgcatgatgtcattgagaggcaggcgctgcat
ctgttaaaggttttgatgggctataaaggccatgctgtagatctgtcagaggattttact
gtggcggccagtaatgtcatcaccactctggctttcggaatagaatatgataagagctca
tcggagctgcaggagttgcacagatgtctcaatgagattgttgctctgtggggctcctct
tggatatcagccctggactctttcccactgcttagaaaattacccaatcctgtttttgcc
cgtcttctgaaagaggtggtcaggagagacaaaatcataacaagacttctcaacaattac
aagtcacaggatgaaaaaaatcaggatgtcatcacaggatccctcctccagggacttgac
aatcagaacacaggagacaaagcgctactaacagatattcatgttcacatggcaacagtg
gaccttcttatcgggggaacagagacttctgcggcctggctagactggatggtggccttc
ctcctgcacagaccagaggtgcaggagagggtatatgaggagctgtgcacagtattggag
ggccgatatcctaaatacagcgacagacacagacttcctgtcctctgctctctgatcagc
gaggtgctcagactcaggccagttgcccctttggcagtaccacacagagccatcagagac
agcagcattgcaggttatttcatccctaagaacacagtcatcattcctaatctttttgga
gcacatcatgatcctgaagtttggcctgacccatacagcttcaaaccagagcgctttctg
aaagaaggaggaggaagcagaggcagctccacccgtgacctgatcccttttggagggggg
gctcggctctgcctgggagagtctgtggccaaaatggagctttttctgttcagtgcctac
ttgctgagagattttcagctcctcctgcctgagagcgagacctcactgcctgatctgaga
ggagttgccagtgttgtgcttaaaatcaagtcctataaagttgtagcacgtccaagacct
gtgactaatccctga

DBGET integrated database retrieval system