KEGG   Oreochromis niloticus (Nile tilapia): 100705330
Entry
100705330         CDS       T06104                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100705330 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100705330 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:onl04052]
    100705330 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:onl00536]
    100705330 (fgf1)
Cytokines and growth factors [BR:onl04052]
 Growth factors
  Growth factors (RTK binding)
   100705330 (fgf1)
Glycosaminoglycan binding proteins [BR:onl00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100705330 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100705330
NCBI-ProteinID: XP_003447042
Ensembl: ENSONIG00000008471
UniProt: A0A669ENK2
LinkDB
AA seq 182 aa
MLAQRGHCHMTLSQTQGHHAASSIPQTLCMMSEGDITVLPIGPGSLDLSKQEAQTLTRLY
CMNGGYHLRILPDGTVNGGRQENDTYDILRLKAVSAGVVVIKGEATGRYLAMNRNGRLCG
VQAVNDECYFLEKYEENHHNTYRSQKYNWYVALKRNGQPKAGPDTHQGQKAVFFLPRPAG
NV
NT seq 549 nt   +upstreamnt  +downstreamnt
atgctggctcaacgggggcactgtcacatgacattgtcacagacacagggacatcacgct
gcttcatccatacctcaaactctctgtatgatgtctgagggagacattacagtgctgcct
attggacctgggtccctggacctgtccaagcaggaagcccagacactgaccaggctctac
tgtatgaatggaggctatcacctaaggattttaccagatggaaccgtcaatggtgggagg
caagaaaatgacacatatgacatcctgaggctgaaggctgtgagtgcgggggtggtggtc
atcaaaggtgaggcgacaggaaggtatctggctatgaacaggaatggacgcctctgtgga
gtacaagctgtgaacgatgagtgttacttcctggagaaatacgaagagaaccatcacaac
acgtatcgttctcagaagtacaactggtacgtcgccttgaagaggaatggccagcccaaa
gcaggaccagacacccaccagggtcagaaggccgtttttttcctgccaaggcctgcaggc
aacgtgtaa

DBGET integrated database retrieval system