KEGG   Oreochromis niloticus (Nile tilapia): 100706106Help
Entry
100706106         CDS       T06104                                 

Definition
(RefSeq) protein kinase C delta type
Organism
onl  Oreochromis niloticus (Nile tilapia)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C C1_2 Kinase-like APH PHD DZR zf-RING_9 Prok-RING_1 DUF2318 Haspin_kinase zf-RING-like Pkinase_fungal Zf_RING
Motif
Other DBs
NCBI-GeneID: 100706106
NCBI-ProteinID: XP_005450312
Ensembl: ENSONIG00000020343
UniProt: I3KWZ0
LinkDB All DBs
AA seq 689 aa AA seqDB search
MPPFLRITLSNYDVGALPPLSDAPICAIRIKESIDTERGKTLVQRKPTMYPPWKSNFDAH
IKEGRVLEVVLMQSTEEPLAKATMGVSVLAERCKSKSRGSGRAEFWVDLQPSGKIQMAVQ
FFLEDGDAVAAKPTAKAPSEDGLMTLNKRRGAVKQPKVLVIKNHEFTSTFFHQPTFCSVC
RDFLWGLNKQGYKCKQCNAAIHRKCSEKIIGKCTRTATNSRETMFQKERFNIDMPHRFKT
YNYKSPTFCDHCGSLLWGLYKQGLKCEDCGMNVHSGCTSKVGNLCGINQKLLAEALSQVS
QKSVKKSGDTPAPDIGIYQDVRNATVDPSAGGNGKSPSPSPSPAPTPTPTTVSQARLSLS
QLTFHKVLGKGSFGKVMLAELKGQGLYFAVKVLKKDVVLMDDDVECTMVEKRVLSLAWNN
PFLTHLYATFQSKEHLFFVMEYLNGGDLMFHIQDKGRFDLNRATFYAAEIIVGLQFLHSK
GIIYRDLKLDNVMLDKDGHIKIADFGMCKENVFGDVKASTFCGTPDYIAPEILCGQKYTF
SVDWWSFGVLVYEMLIGQSPFQGDDEDELFESIRSDVPHYPRWISKESKSLLELLFERDP
TRRLGVVGDIRGHAFFKNINWAALERRQVEPPFKPKVKSPSDHSNFDREFLNEKPRLSHA
DKNLIDSMDQAAFAGFSFINPKLEPKITK
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgccacccttcctgcgtatcaccctcagtaattacgatgtgggcgcgctgcctcctctt
tctgatgctcccatctgtgccatcaggataaaagagtctatcgacacagagagagggaag
accctggtccagaggaagcccaccatgtaccccccctggaaatccaattttgatgctcat
atcaaggaggggcgtgtcctagaagttgttcttatgcagagtactgaggagccattggcc
aaggccacaatgggcgtgtctgtgctggcagagcgctgcaaatccaagtctagaggcagc
ggtcgtgctgagttctgggtggacctgcagccttctgggaagattcagatggctgtgcag
ttttttttggaggatggtgatgcagtggctgctaagccgacagcgaaggctccttctgaa
gacggcttaatgaccctgaacaagaggaggggtgcagtcaagcagcccaaggttcttgtc
atcaagaaccatgagttcacctccaccttcttccaccagcccaccttctgctctgtctgt
agagactttctctgggggctcaacaagcaaggatacaaatgcaaacaatgcaatgcagca
atccacaggaaatgcagcgagaaaatcattggcaagtgcactcgaacagcgaccaacagt
cgtgagactatgttccagaaagaacgtttcaatattgacatgccacatcgctttaaaact
tacaactacaagagccccaccttctgtgaccactgtggaagtctactgtggggtctgtac
aagcagggcctgaaatgtgaagactgtggcatgaacgtacatagtggctgcacaagcaaa
gtgggcaatctttgtggaatcaaccagaaactactagcagaggctttgtctcaagtctcc
cagaaatctgtgaagaaatctggtgacacccctgcaccagatattggaatctaccaagat
gtcagaaatgcaacagtggaccctagtgcaggtggcaatgggaagagccctagccctagc
cctagccctgccccaaccccaaccccaactacagtttcccaggcacgcctctcgctcagc
cagctaacattccacaaggttctgggaaaaggcagctttggcaaggtgatgcttgcagag
ctgaagggacagggcctgtactttgctgtgaaggtcctgaagaaggacgtcgttctcatg
gatgacgatgtggagtgcaccatggtggagaaaagagtcctttccctcgcctggaacaac
ccttttctcactcatctctatgccacattccagtcaaaagagcacctcttctttgtaatg
gagtacttgaatggaggtgacttgatgtttcacatccaagacaagggccgatttgatctc
aacagagctacattctatgctgctgagattatagtgggactgcaattcctccactcaaag
ggaattatctacagagacctgaagctggacaatgtgatgctggacaaggacggacacata
aagatagcagactttggcatgtgcaaagagaatgtctttggagatgtcaaagcgagcaca
ttctgtgggacaccagattatatcgcaccggagatcctgtgtggacagaagtacacattc
tcagtggactggtggtcttttggtgtcctggtgtatgagatgctaattggtcagtcgcct
ttccaaggtgacgatgaggatgagctctttgaatccatcaggtcggacgttcctcactac
cctcggtggatctccaaggagtccaagagcctgcttgaactgttgtttgagcgagatccc
actcgcagattgggtgttgtgggggacatccgaggacacgcattcttcaaaaacattaac
tgggcagcactggagaggagacaagtggagcctcctttcaagcctaaagtgaaatccccc
agtgaccacagcaactttgatcgtgagttcctgaatgagaagccgcgtctctcccatgct
gacaaaaacctcattgattctatggaccaggcagctttcgctggtttttccttcatcaac
cccaaactggaacccaaaataaccaaataa

DBGET integrated database retrieval system