KEGG   Oreochromis niloticus (Nile tilapia): 100706539
Entry
100706539         CDS       T06104                                 

Gene name
egf
Definition
(RefSeq) pro-epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04012  ErbB signaling pathway
onl04020  Calcium signaling pathway
onl04068  FoxO signaling pathway
onl04510  Focal adhesion
onl04540  Gap junction
onl04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100706539 (egf)
   04012 ErbB signaling pathway
    100706539 (egf)
   04068 FoxO signaling pathway
    100706539 (egf)
   04020 Calcium signaling pathway
    100706539 (egf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100706539 (egf)
   04540 Gap junction
    100706539 (egf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100706539 (egf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:onl04052]
    100706539 (egf)
Cytokines and growth factors [BR:onl04052]
 Growth factors
  Growth factors (RTK binding)
   100706539 (egf)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA DUF5050 EGF_3 EGF EGF_MSP1_1 DUF4494
Other DBs
NCBI-GeneID: 100706539
NCBI-ProteinID: XP_005467322
UniProt: I3IXR8
LinkDB
AA seq 1169 aa
MPEAMITVILIYFMMQTAGALLLGTTCWDEHLLQAGSNSSCTASQPFLIFGHGKAIHRMG
LNGKNHRRLVPGVGSSILLDFHFKEQRVYWVDRHTGVIYKASVKGAHKQKLYSYDKHISG
LAVDWIWNSVYWTSGEKGEVKRIDINGRKQRTLLRHLTQPNSITVDPSNRFLFWLSAGMS
PSIQRSDVTGQMKITLIKITEQLRALSIDRVDKRLFWVQFGPQGESAIASCDYNGNALHI
MNLPLQSHSVGISVFLEHIYYTDAESRVIKQVNKYTGGEPRVVNLKQMAKPPVDIKIVHP
LNQPTADPLSPFPGCDDQGGNCVNVCSSLADQGVCQCSEGFVLSMEGTYCKDVNECAHWN
HGCSLGCENIPGSYFCTCPKGYALLPDRKTCQEIIPCERNMTKCGNGCLSTGNGAVCVCP
EGSILQEDGQTCTGCSSADRGGCSQLCNPVTPVSWECGCLPGYQLHQDGKHCIATGPPSY
LLVANLVDVRRINPDGTVDQILAEEPRGIILALDYDPVQNNVYFASASQKTIERVDIKGG
PRNILISDGLDSPEGLAVDWVHRKMYWTDKSQSTVDCSTLDGLHRETIVRKGLEKPRGIA
VHPLAKKLFWTDIGTHPVVECSSLEGRDRAVIARTNLVSPTGLTIDFTEDRVFWCDQRKG
TIETAALDGSDRRVLSENQVGQPFDLALFEDRLWISDQERHQLTSVHKRTGKNLQRIQGS
MVQPASIVVVHPLAKPGADMCLHLNGGCSQVCESKVGFAHCSCFSHYILSADGKTCLSVD
ASNGTAEYGNSGSVDLTPLKNKTFNTASLPLTTDKGETDFHSDVSSQPTFFTEKMISDQN
ECYSLRCDVNAQCLLNSGHPNCLCQEGFTGDGQLCVDIDECTLGTYNCDKNEECQNTAGK
YYCKCLAGYYSDGQSCQELEPTSPWVTPATSPDVTTKHHSRNAVESCPATHETYCLYHGV
CYYFPELDSYACNCVSGYMGERCQFSDLEWLELQRAEKEKKRNVVITACMVVLVSVLSIT
ACVTYCYGTRKRFRKQPSVDNVSETSMTDESMSETTTTTVPRFYMVAENGVEGKVIPAMG
CPRRAVCTSCSSETGANSESDESGKLSQHNKGYECSMVSAVATETMQPTVHLSSPSLSSC
TSFKPTTLPQTSGPESWLNGNSVQSAVQK
NT seq 3510 nt   +upstreamnt  +downstreamnt
atgcccgaggcaatgataacagtaatattgatctattttatgatgcaaaccgctggagcc
ttgctgctcggtacgacatgttgggatgagcacctattgcaagcagggagcaacagtagc
tgtacggcttcacagcctttcctgatatttggccatggtaaagctattcatcggatgggc
cttaatggcaagaatcacagaaggcttgtgcctggcgtcggaagctctatcctgcttgac
tttcatttcaaagaacagagagtttactgggttgacaggcacactggggtcatttacaaa
gcatctgtgaaaggagcacacaaacagaaactgtattcatatgacaaacacatctctggc
ctcgcagtggactggatttggaacagcgtatactggacaagtggagaaaagggggaagta
aagagaatcgatataaatgggaggaaacagaggactcttttaagacacttgacccagccc
aattctataactgttgatccctctaataggtttctgttttggttatctgcggggatgtct
ccaagtatccaaaggtctgatgtcacaggacagatgaaaattacactaattaagataact
gaacaactgagagcactgtcgattgaccgagtagacaaaagactgttctgggttcagttt
gggccacaaggagaaagtgccattgcctcttgtgattacaatgggaacgccctacacatc
atgaatcttccacttcagtctcattcagttggaatatctgtttttctggagcacatatac
tacactgatgctgagtctcgggttataaaacaagtaaacaagtacactggtggagagcca
cgtgttgttaacttaaaacaaatggcaaaacctccagttgatatcaagatcgtgcatccc
cttaatcagccaacagcagacccgctatcaccatttccaggttgtgatgaccaaggtggc
aactgtgttaacgtctgttccagtttggcagaccaaggggtttgtcagtgcagtgaaggt
tttgttctcagtatggaaggcacttactgtaaagatgtaaatgaatgtgcccactggaat
catggttgctcgcttggttgtgagaacattcctggatcttatttctgtacctgtcctaaa
ggatatgccctcttaccagacaggaaaacatgccaagaaatcataccatgtgaaaggaat
atgacaaagtgtggcaacgggtgcctgtcaacaggaaatggtgctgtctgtgtttgccct
gagggatctatactacaggaggatggacaaacatgcactggctgttcatctgcagataga
ggagggtgcagtcagctctgcaaccctgtcacccctgtaagctgggagtgtggctgtctg
cctggctaccagctccaccaagatggcaagcactgcattgcaactggacctccatcctat
ctactagttgctaatctagtagatgtccggagaattaaccctgatggcactgtggatcaa
atcttggcagaggagcccagaggaataatcttagctttagactacgaccctgtccagaac
aatgtgtactttgcaagtgcaagccagaaaacaattgagcgagttgacataaaaggtggc
ccaagaaacattctcatctctgatggtttggattcaccagaggggcttgcagttgactgg
gttcatcgcaagatgtactggacggataaaagtcagtcaactgttgactgcagtacctta
gatggacttcacagggaaactattgtgagaaaaggtctggaaaagccaagaggaatcgca
gttcatcctcttgcaaagaagttattctggactgacatagggacccatcctgtggtggaa
tgttcctccctggaagggagagaccgtgctgtcattgctaggaccaaccttgtgtcgccc
actggcctgacaattgacttcacagaggaccgagtattctggtgtgatcagaggaaaggc
acaatagagactgccgccctggatggttcagatcgacgagtcctgtcagagaaccaagta
ggccaaccttttgatcttgcactatttgaagacaggctctggatctctgatcaggaacgc
caccagctgaccagcgtacataagcggactgggaaaaacttgcaacggatccaaggaagc
atggtgcaaccagcatctattgttgtagttcatccccttgctaagccaggggcagatatg
tgccttcacctgaatggaggttgttcccaagtgtgtgaaagcaaggtgggttttgcccac
tgctcttgtttctcacactatatcctatcagctgatggaaaaacttgcttgtctgttgac
gcttcaaatggaacagcagaatatggaaacagtggatcagttgatttaacacctctgaaa
aacaaaacatttaatactgcgagcttgccactgacaactgataaaggggagactgatttc
cactcagatgtaagcagccagcccactttcttcacagagaaaatgatttcagaccagaat
gagtgttactcactccgctgtgatgtgaatgcacaatgcctgctgaattctggtcatccg
aactgtttatgtcaagaaggtttcacaggtgatggacagttatgtgtggatattgatgaa
tgtaccctgggaacatacaactgtgacaaaaatgaagaatgtcaaaacactgcagggaaa
tactactgcaagtgcctggctgggtactacagcgatgggcagtcatgtcaagagttggag
cccacatcaccatgggtgacacctgctacctctcctgatgttaccaccaaacaccacagc
agaaatgcagtggagagttgtcctgcaacccatgagacctactgtctgtaccatggtgta
tgctactattttcctgaattggactcttatgcctgcaattgtgtatcaggctacatgggg
gaacgatgtcagttcagtgacctggaatggttggagcttcagcgggctgaaaaggagaag
aagaggaacgtggtcattacagcctgcatggtggtcctcgtttccgtgctctctatcaca
gcctgtgtcacctactgctatggaacgagaaaacgcttccgcaaacagccatcagtggat
aatgtgagtgagaccagcatgacggatgagagcatgtcagagacaaccactaccactgtt
cctcggttctacatggtggcagaaaatggtgttgaaggaaaggtaatccctgccatgggc
tgtccaaggagagctgtgtgtacatcctgctcttcagagacaggtgccaattctgaaagt
gatgagtcaggaaaactgtcccagcacaacaaaggttacgagtgctccatggtgtctgct
gttgccactgaaacaatgcaacccactgtgcacctctcaagtccatcactgtcaagctgt
acatcttttaaaccaacaacgttaccccagacttccggtccagagtcatggctcaatgga
aacagcgtacaatcagctgttcagaaatga

DBGET integrated database retrieval system