KEGG   Oreochromis niloticus (Nile tilapia): 100707671
Entry
100707671         CDS       T06104                                 

Gene name
epo
Definition
(RefSeq) erythropoietin isoform X2
  KO
K05437  erythropoietin
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100707671 (epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:onl04052]
    100707671 (epo)
Cytokines and growth factors [BR:onl04052]
 Cytokines
  CSF and other factors
   100707671 (epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100707671
NCBI-ProteinID: XP_003457688
Ensembl: ENSONIG00000019900
UniProt: I3KVB0
LinkDB
AA seq 185 aa
MLQKTGRGLLALLLLVLDWTQPGLSSPLRPICDLRVLNHFIQEARDAEGAMKSCREGCGL
SQSVTVPQTTVDFDVWEKKNALEQAQEVQTGLWLLQQSLNTLQTSVTNTAMHSHIDNTIR
NLLSINAVLRSLNIQEFTPPANATDLEGTWRVSLATELLQVHVNFLRGKVHLLLSSAQAC
KPDVS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgttgcagaaaacaggtagaggactgcttgccttgctgttgttagtgttggactggacc
cagccaggcttgtcatccccactgaggccaatttgtgacctgagggtcctgaaccatttc
atacaggaagcacgagacgcagaaggtgctatgaagtcatgtagagaaggctgtggcctg
tcccagtctgtcaccgtcccccagactacagtagactttgatgtatgggagaagaaaaat
gcactggagcaagcccaggaggtgcagactggtttatggttgttacaacagtccctcaac
acgctccagacgtcggtcaccaacacagcaatgcacagtcacatagacaacaccatcaga
aacctgctcagcatcaacgctgtgctgcgtagtctcaacatccaggaatttacaccacca
gcaaatgcaacagaccttgagggaacatggagggtgtccttagcaacagagctgcttcag
gtccacgtcaacttcctgcgaggcaaagtgcaccttcttctttcgagtgcacaggcatgc
aagccagatgtcagctga

DBGET integrated database retrieval system