KEGG   Oreochromis niloticus (Nile tilapia): 100707676
Entry
100707676         CDS       T06104                                 

Gene name
rela
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04137  Mitophagy - animal
onl04210  Apoptosis
onl04218  Cellular senescence
onl04620  Toll-like receptor signaling pathway
onl04621  NOD-like receptor signaling pathway
onl04622  RIG-I-like receptor signaling pathway
onl04623  Cytosolic DNA-sensing pathway
onl04625  C-type lectin receptor signaling pathway
onl04920  Adipocytokine signaling pathway
onl05132  Salmonella infection
onl05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100707676 (rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100707676 (rela)
  09143 Cell growth and death
   04210 Apoptosis
    100707676 (rela)
   04218 Cellular senescence
    100707676 (rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100707676 (rela)
   04621 NOD-like receptor signaling pathway
    100707676 (rela)
   04622 RIG-I-like receptor signaling pathway
    100707676 (rela)
   04623 Cytosolic DNA-sensing pathway
    100707676 (rela)
   04625 C-type lectin receptor signaling pathway
    100707676 (rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100707676 (rela)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100707676 (rela)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100707676 (rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:onl03000]
    100707676 (rela)
Transcription factors [BR:onl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100707676 (rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer CAP_N
Other DBs
NCBI-GeneID: 100707676
NCBI-ProteinID: XP_025761398
Ensembl: ENSONIG00000001545
LinkDB
AA seq 610 aa
MDPGYGWSLTPLNQAPYIEIIEQPKQRGMRFRYKCEGRSAGSIPGEKSNDTTKTHPAIKV
HNYNGPLRVRISLVTKNAPYKPHPHELVGKDCKHGYYEADLQERRIHSFQNLGIQCVKKK
DVNEAITCRLQTNNNPFNIPEAKVWEEEFDLNSVRLCFQASITLSTGELYPLEPVVSQPI
YDNRAPNTAELKICRVNRNSGSCKGGDEIFLLCDKVQKEDIEVRFFQDSWEGKGTFSQAD
VHRQVAIVFRTPPYRDTNLTEPVRVKMQLRRPSDREVSEPMDFQYLPSDPDEYRLSEKRK
RTGDIFQNLKLGPLLSSVTTPQDRQHLNPSRRKLTAKPPQAAAVVPTGPLGAKSHTQYFQ
PGQLFSEQTKVEASNMSAAPTNQWKMTGLGSQPKANPVSSFSMNPSPATVSSTIASTSNQ
DYSTVNLSDLHEFFPNISSTITQQEPSASQINLASSQTSNSFALQSTQFRADPTLVDDDI
PDFPSFTEGQVPVNLDSLNMDDLEDLLNPQLVGVNHPSCHQTGPSASSTAAQTSAAPQNT
SDPASTPGSTWMNYPNSIVHLLQNEIMTDSRPNNNQMLEDFDELMSADEDRLISIFNSGS
QAGFVSGHPT
NT seq 1833 nt   +upstreamnt  +downstreamnt
atggaccctggatatggatggagccttaccccgctcaaccaggctccctacatagagatt
atcgagcagccaaagcaaagggggatgagatttaggtacaagtgtgagggacggtctgct
ggcagcattcccggagaaaaaagtaatgacaccactaagacccacccagcaatcaaggtg
cacaactacaacggccccctgcgtgttcgcatctcattggtgacaaagaacgcaccctac
aagcctcatcctcatgagctggttggaaaagactgcaaacatggctactatgaggctgac
ctgcaggagagacgaatacacagttttcagaacctgggtatacagtgtgtgaagaagaag
gatgtaaatgaggccatcacttgtagactgcagacaaacaataacccctttaacattcct
gaggctaaggtgtgggaggaagagtttgacctaaattcagtccggctttgcttccaggcc
tccataactctctctacaggggagctctatcctctggagcctgttgtatcacagcccatc
tatgacaacagggctccaaacacagcagagctaaagatctgcagagtcaaccgcaactct
ggaagctgcaaaggaggggatgaaatctttctgctgtgtgacaaagtgcaaaaagaggac
atcgaggtgcgtttcttccaagactcctgggaggggaagggcactttctcccaggctgat
gtccacaggcaggtggccattgtgtttcgcacaccgccctatcgtgacactaacctcact
gagccagtgagagtcaagatgcagctccggcggccctctgatcgagaagtcagtgagcca
atggacttccagtacctgccatcagatccagatgaatacaggctgagtgagaagagaaag
cggacaggagacatattccagaacctgaagctagggcccttgctatctagtgtgaccact
ccacaagatagacagcacctaaacccatcaaggagaaagctgacagccaagcctccacaa
gctgcagctgtggtgcctactggtccccttggggcaaaatcacatacccaatacttccaa
cctggccagctattttcagagcagacaaaggtagaagcctctaacatgtcagcagctcct
accaaccagtggaagatgacaggcctgggctcccaaccaaaagcaaacccagtgtctagc
ttttcaatgaacccatcaccggccaccgtctcctctaccatcgcttccacttccaatcag
gactactcaacggtcaacctgtcagatcttcatgaattcttccccaacatttcctcgact
atcacccagcaggagccctcagcttctcaaataaacttggcctcctcacagacaagcaac
tccttcgccctccagagcactcagttccgggcggacccaacacttgtggatgacgatatc
ccagatttccctagcttcactgaaggccaggtcccagtcaacctggacagcctcaacatg
gatgacttggaggatcttctgaacccccagcttgttggtgtaaatcatccttcatgtcat
cagactggcccttcagcctcctctaccgctgcccagactagtgcagcacctcagaacact
tctgaccctgccagcactccaggaagcacttggatgaattaccccaacagcatcgtgcat
ctgctccagaacgaaatcatgacagacagcagacccaataacaaccaaatgctcgaagac
ttcgatgagttgatgtctgcagatgaggaccgtcttatttccatttttaacagtggaagc
caagctgggtttgtgtcaggacacccgacttaa

DBGET integrated database retrieval system