KEGG   Oreochromis niloticus (Nile tilapia): 100709597
Entry
100709597         CDS       T06104                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04012  ErbB signaling pathway
onl04068  FoxO signaling pathway
onl04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100709597 (cdkn1b)
   04068 FoxO signaling pathway
    100709597 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100709597 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100709597
NCBI-ProteinID: XP_003443967
Ensembl: ENSONIG00000008829
UniProt: I3JQF9
LinkDB
AA seq 184 aa
MSDVRLSNGSPTLERTDSRQSEHPKPSACRSLFGSVDHEELKRDLKGHLRELEERASDQW
GFDFATDTPRANSRFEWKLVDCRDLPGFYTRQPLTKKGVCSTGNNNVDLNGNHSCVVVPP
SEDPDRADGQMECTEQCTALRKRHACHDSPVPSKRSHSSSDVSCPSRSHSAEHTPRKTSP
KRKT
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaacgggagcccgacgctggagcggacggactcacggcag
tctgaacacccgaaaccctcagcctgcaggagcctcttcggctcggtggatcacgaagag
ttaaagagggatttaaagggacatttgcgggagttggaagagcgcgcctccgaccagtgg
ggcttcgacttcgccactgacacgccgagggccaactccaggttcgagtggaaactagtg
gattgcagagacctgccgggcttctacactcggcagccgcttacgaagaaaggcgtctgc
tccactgggaataacaatgtggatcttaacgggaatcacagttgtgttgtggtgcctccg
agcgaagatcccgacagggctgacgggcaaatggagtgcacggaacagtgtacagcgctg
aggaaaagacacgcgtgtcacgactcccctgttccgagcaagaggtcacacagcagctca
gatgttagttgtccaagtcggagtcactctgcagagcacacgcccagaaagaccagtccc
aagaggaaaacgtga

DBGET integrated database retrieval system