KEGG   Oreochromis niloticus (Nile tilapia): 100712573
Entry
100712573         CDS       T06104                                 

Definition
(RefSeq) TGF-beta receptor type-2-like precursor
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04060  Cytokine-cytokine receptor interaction
onl04068  FoxO signaling pathway
onl04144  Endocytosis
onl04218  Cellular senescence
onl04350  TGF-beta signaling pathway
onl04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100712573
   04350 TGF-beta signaling pathway
    100712573
   04068 FoxO signaling pathway
    100712573
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100712573
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100712573
  09143 Cell growth and death
   04218 Cellular senescence
    100712573
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100712573
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:onl01001]
    100712573
Enzymes [BR:onl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100712573
Protein kinases [BR:onl01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   100712573
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal FlaC_arch
Other DBs
NCBI-GeneID: 100712573
NCBI-ProteinID: NP_001298255
Ensembl: ENSONIG00000013839
UniProt: A0A0E3M3Y5
LinkDB
Position
LG11
AA seq 597 aa
MKARRCSLTFRGVLSAFLISVLLEPGAAGLDVFQLHELCKFCDVEPTSCNGTGICKTDCS
ISSICEKPTEVCVSIWRRNETNMSIETLCHNPAEPLYGITLDDYNSTTCVMKEKNTTTGL
AHLCSCKGAECNEELIFSQSDRIMEDGDAVDPTPDPLESKDSLMSVVLVSMLPLLVMVIA
FFGMFYWCRIHRQRRPNRQWESSFNFKRKPIAGGLDCSDACAIMTDVDKSDSSPTHANSL
NHNTEPLPIELDLLVGKGRFAQVYKAKLKQTTWNQFETVAVKVFPYEEYASWKNEKDIFS
NTDLRHENILHFLTAEERKVEKQYWLITAFHPRGNLQEYLTHHVISWQELQVLSSSLARG
VAHLHSDRLPCGRPKVPIVHRDLKSSNILVKNDGTCCVCDFGLGLCLDSSLSVDDLANSG
QVGTARYMAPEVLEARLNLENIESFKQTDIYSMALVLWEMTSRCEAIGEVKDYEPAYGSK
VREHPCVESMKDNVLRDRGGPEIPDSWLRHQGMAVMCATIKECWDHDPEARLTAHCIAER
ISELEDEMGKLSSRSSSAEKIVEELKIPIEVEIPEEEVKITEIQNIIAVDCSISDKK
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgaaggcacggcgctgctctctaactttccgcggagttttatcagcctttctcatatct
gtgcttctggagcccggggctgccggtcttgatgtttttcaactacatgaactttgtaag
ttctgtgatgtggagcctacctcctgcaatggcacaggtatctgcaagaccgactgcagc
atctcatccatatgtgaaaaaccaactgaggtctgtgtttctatctggagaaggaacgaa
acaaacatgtccatcgaaacactctgccacaacccagcagagccgttgtacggcattact
ctggatgactacaacagcaccacctgtgtgatgaaggaaaagaacacaacaacggggttg
gctcatctctgctcctgtaaaggagcagagtgcaacgaagagctaatattctcccaaagt
gataggatcatggaggatggagacgctgtggatccaactccagatccactggagtccaag
gactctttgatgtctgtagttctggtgagcatgctgcccctgctggtgatggtgatcgcg
ttttttggaatgttctactggtgcagaatccatcggcagaggcgtcccaaccgccaatgg
gagagcagctttaactttaagcgcaagccgatagccggtgggctggactgcagtgacgcc
tgcgccatcatgacagatgttgataagtcagacagcagcccaactcatgccaacagcctg
aaccacaacacagagccgctgcctatagagctggatctgctggtgggaaagggtcgcttt
gctcaggtatacaaggctaaattgaagcagactacatggaatcagtttgaaacagtagct
gtaaaggtcttcccctatgaagagtatgcatcctggaagaacgagaaggacattttctcc
aacacagacctcagacatgagaatatcctccacttcctgacagctgaggagcggaaggtg
gagaaacagtactggcttatcacggccttccaccccagaggaaacctacaggagtacctg
acgcatcacgtgatcagctggcaggagctgcaggtgttgagcagctctctggcacgaggt
gtcgcacatctccacagtgatcgcctcccctgtggacgccctaaggtgccgatagtccat
cgagacctaaagagctccaacatcttggtgaagaacgacgggacgtgctgtgtttgtgac
tttggcctgggactctgtctggacagcagcctgtcagtggatgaccttgccaacagtgga
caggtgggcactgcgcgctatatggcaccagaggtgctggaggcccgtctaaatctggag
aacatcgagtctttcaagcagactgacatttactccatggctctggtcctgtgggagatg
acgtcaaggtgtgaagctattggagaggtaaaggattacgagccggcgtatggctctaaa
gtgcgagagcacccctgtgtggagagcatgaaggacaatgtgctgagagacagagggggg
cctgagatccccgacagctggctcaggcaccagggcatggcagtgatgtgcgccaccatt
aaggaatgctgggaccacgatcccgaggcccgcctcaccgcacactgcattgccgaacgc
atctctgagctggaagacgagatgggcaagctgtccagccggagctcctcggcggagaag
attgtagaggaactgaagatcccaatagaggtggagatcccagaggaggaggtgaaaatt
acagaaatacaaaacatcatagctgtggactgctccattagcgacaagaagtga

DBGET integrated database retrieval system