KEGG   Oreochromis niloticus (Nile tilapia): 102080356
Entry
102080356         CDS       T06104                                 

Definition
(RefSeq) uncharacterized protein LOC102080356
  KO
K05461  KIT ligand
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04010  MAPK signaling pathway
onl04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102080356
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102080356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:onl04052]
    102080356
Cytokines and growth factors [BR:onl04052]
 Growth factors
  Growth factors (RTK binding)
   102080356
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 102080356
NCBI-ProteinID: XP_005451766
Ensembl: ENSONIG00000011774
LinkDB
AA seq 253 aa
MRKKILKAPCLLLSLVTSLNLCSGKFGSPITDDVNKLPVLKQNIPYDYEIPVSYIPKEVA
GTCWVVLNIYPLEQSLRKLANTFGTISTNKDNVLLFIAMLKSLRFTLDHERLETAMQSFQ
CHYQEHGLLTGPYFDYIRDFLHTAAQGPTDFSCEPPPCLSTEQTPGIHEENRGDAWSRRS
PLLLVLIPFIVCVALIVWLVKSGKRLPVCNTENSQMEPSDTIPTVSISIPLQTLTHAADA
QPEREAIAEHESG
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcttgaaagcaccttgtctcctcctgagtctggtaacaagtttgaat
ctttgctctggaaaatttgggtcaccaataactgatgatgtgaacaagctgccagtattg
aagcagaatatcccctatgattatgagattcctgttagttacattcccaaagaagtggct
ggcacctgctgggtggtgttaaatatctatccactggagcaaagtcttcggaagctggcc
aacacgtttggcaccatctccaccaacaaagacaacgtactcctcttcattgcaatgctc
aagagtttacgcttcaccttagaccacgagaggctggaaacggcgatgcagagcttccag
tgtcactatcaggaacatggcttactgactggtccttactttgactacatcagagatttc
ttacacactgctgctcaaggaccaactgacttctcctgtgagccaccaccatgccttagt
actgaacaaacaccagggattcatgaagagaatcgtggggacgcttggtcgagaagatct
cccctgcttttggttctcatccccttcatcgtttgtgttgctctcatagtgtggttggtc
aagtctggaaagcgtttaccagtatgcaacactgaaaatagccaaatggaaccttctgac
acgatcccgactgtgtctatctccatcccacttcaaacactcacccacgctgctgacgct
cagccagagcgggaagcgatagctgaacatgaaagtggatga

DBGET integrated database retrieval system