KEGG   Oreochromis niloticus (Nile tilapia): 102083324
Entry
102083324         CDS       T06104                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
onl  Oreochromis niloticus (Nile tilapia)
Pathway
onl04012  ErbB signaling pathway
onl04068  FoxO signaling pathway
onl04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:onl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102083324
   04068 FoxO signaling pathway
    102083324
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102083324
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102083324
NCBI-ProteinID: XP_005455615
LinkDB
AA seq 182 aa
MCNKMSDVRLSNASPVERVDARQQDNVRPSVRRNLFGRPDPDEIRRDAETSEREEVQRFR
ETYDFDLVEGRPLAPRSYDWVQDDDAPEFYSRQPHSRPRGSPGDSNRLDNDGGERPSGLQ
PGKNGSRKRSAEDADSCSTECMTKRSRSSDGGDDDDDNDDKSDGAGSQTITAAEERPGKP
EG
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtgcaacaaaatgtcagatgttcgcctttctaacgcgagcccggtggagagggtggat
gctcggcagcaggacaacgtcagaccttcggttcgcagaaatcttttcggtagaccggac
ccagacgagatccgcagggatgcggagacttcggagcgagaggaggtgcagcgtttcagg
gagacttacgatttcgatctggtggaaggcaggccgctcgctccgcgcagttacgactgg
gtgcaagacgacgacgcaccggaattttatagcaggcagcctcacagcagaccgagaggc
tctcccggagacagcaaccggctggataacgacggcggtgagaggccgtcgggtctccaa
ccaggcaaaaacggttcgaggaaaaggagtgcagaagatgcagactcttgctccaccgag
tgtatgactaaaaggtcgcgtagtagcgatggtggcgacgacgacgacgacaacgatgac
aagtcggatggtgcaggaagtcagacgataacagccgcggaggagagacccggcaaaccc
gagggctga

DBGET integrated database retrieval system