KEGG   Oenococcus oeni: OEOE_0189Help
Entry
OEOE_0189         CDS       T00408                                 

Definition
(GenBank) Disulfide bond chaperones of the HSP33 family
  KO
K04083  molecular chaperone Hsp33
Organism
ooe  Oenococcus oeni
Brite
KEGG Orthology (KO) [BR:ooe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ooe03110]
    OEOE_0189
Chaperones and folding catalysts [BR:ooe03110]
 Heat shock proteins
  HSP33
   OEOE_0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ABJ56180
UniProt: Q04H92
LinkDB All DBs
Position
179719..180618
Genome map
AA seq 299 aa AA seqDB search
MDYLAKSITKNGHFRAYVADASNVVKQMTEMHKMSPDVTVAFGRTLIATALVGSSLLKED
DQMHISINGRGPIGQIVTETNSKSELRGYVTNPKAIAKTNTNGEADISNLVGLNGTLRVT
KVHPGLDPYTGEVKLVTGQIGDDFTYYLAQSEQIPSAVGVSVFVDSKGLVKSAGGFLLQT
LPGANDTELDLLEQHLRKMPNISSMLAEGLSANQILAQLFANLKVDILETIPLKTADELP
KKWYADAIGTLPKKEIQAMIDEDHGAEIVSRFTEKKYNFSKEELKKILALKMDKKLGEE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggattatttagcaaaaagtattactaaaaatggtcattttcgtgcctatgtggctgat
gcatcaaatgttgtcaagcaaatgactgaaatgcataaaatgagtcctgatgtaacagtc
gctttcggacgaaccttgattgcaactgctttggttggaagctctttattaaaggaagac
gatcaaatgcatatcagcattaatggtcgtgggccgattggacaaattgttactgagacc
aattccaaatcagaacttcgtggttatgttaccaatccgaaagcaattgccaaaaccaat
acaaatggtgaagcagatatttctaatcttgtaggtctaaacggcactttaagggtaaca
aaggttcatccgggattagatccctataccggcgaagtaaaattagtgactggccaaatc
ggtgatgattttacttattatttggcccaatccgagcaaataccgagcgctgttggtgtt
tcggtttttgtcgattcaaaaggtttggttaaatctgccggtggttttttgcttcaaact
ttgcctggagctaatgatactgaattggatttactggaacaacatttaagaaaaatgccg
aatatttcttcaatgttggccgaagggctgagcgcaaaccagattttggcacaattgttt
gccaacctgaaagttgatatccttgaaacaattccattaaaaacagctgatgaattgcca
aagaaatggtatgccgatgcaattggaacattgccaaaaaaagagattcaagcgatgatc
gatgaagatcacggagcggaaatcgttagtcgtttcacggaaaaaaaatacaatttttct
aaagaagaattaaaaaagattttagccttgaaaatggataaaaaattgggtgaagaataa

DBGET integrated database retrieval system